Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TAX1BP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86VP1
Molecular weight:
17.41 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
His16–Lys146
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TAX1BP1 Protein, N-His

Product name ARO-P12262-100
Uniprot ID Q86VP1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTK
Molecular weight 17.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His16-Lys146
Aliases /Synonyms Tax1-binding protein 1, TAX1BP1, TRAF6-binding protein, T6BP
Reference ARO-P12262
Note For research use only.
Molecular Constructor
His16–Lys146
Product name ARO-P12262-1MG
Uniprot ID Q86VP1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTK
Molecular weight 17.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His16-Lys146
Aliases /Synonyms Tax1-binding protein 1, TAX1BP1, TRAF6-binding protein, T6BP
Reference ARO-P12262
Note For research use only.
Molecular Constructor
His16–Lys146
Product name ARO-P12262-50
Uniprot ID Q86VP1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTK
Molecular weight 17.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His16-Lys146
Aliases /Synonyms Tax1-binding protein 1, TAX1BP1, TRAF6-binding protein, T6BP
Reference ARO-P12262
Note For research use only.
Molecular Constructor
His16–Lys146

Introduction to Recombinant Human TAX1BP1 Protein

Recombinant Human TAX1BP1 Protein, also known as Tax1-binding protein 1, is a type of protein that is produced through genetic engineering techniques in a laboratory setting. This protein is a key player in various cellular processes and has been extensively studied for its structure, activity, and potential applications in the field of medicine.

Structure of Recombinant Human TAX1BP1 Protein

The Recombinant Human TAX1BP1 Protein is a 75 kDa protein that is composed of 684 amino acids. It is primarily composed of alpha-helices and beta-sheets, giving it a globular shape. The protein is highly conserved, with a 99% similarity among various species, indicating its importance in cellular functions.

The protein contains several functional domains, including the ubiquitin-binding domain (UBD), ubiquitin-like domain (ULD), and the coiled-coil domain (CCD). These domains play a crucial role in the protein’s function and interaction with other cellular components.

Activity of Recombinant Human TAX1BP1 Protein

Recombinant Human TAX1BP1 Protein is primarily known for its role in regulating the NF-κB signaling pathway. It acts as an adaptor protein, interacting with various components of the pathway, including the NF-κB subunits and the IKK complex. This interaction leads to the inhibition of NF-κB activation, thereby regulating the expression of genes involved in inflammation and immune response.

In addition to its role in the NF-κB pathway, Recombinant Human TAX1BP1 Protein also plays a crucial role in autophagy, a cellular process that involves the degradation and recycling of damaged or unnecessary cellular components. The protein interacts with several autophagy-related proteins, including LC3 and p62, to regulate the formation of autophagosomes and the degradation of cargo within them.

Furthermore, Recombinant Human TAX1BP1 Protein has been shown to play a role in cell proliferation and survival, as well as in the regulation of viral infections. It has been found to interact with viral proteins and modulate their activity, highlighting its potential as a therapeutic target for viral diseases.

Applications of Recombinant Human TAX1BP1 Protein

The unique structure and activity of Recombinant Human TAX1BP1 Protein make it a promising candidate for various applications in the field of medicine. Its role in regulating the NF-κB pathway makes it a potential target for the treatment of inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease.

Moreover, its involvement in autophagy suggests its potential in the treatment of neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease, which are characterized by the accumulation of damaged proteins in the brain. By regulating autophagy, Recombinant Human TAX1BP1 Protein could potentially aid in the clearance of these toxic proteins and slow down the progression of these diseases.

Additionally, the protein’s interaction with viral proteins makes it a potential target for antiviral therapies. By inhibiting the activity of viral proteins, Recombinant Human TAX1BP1 Protein could potentially prevent viral replication and reduce the severity of viral infections.

Conclusion

In conclusion, Recombinant Human TAX1BP1 Protein is a crucial protein involved in various cellular processes, including the regulation of the NF-κB pathway, autophagy, and viral infections. Its unique structure and activity make it a promising candidate for various applications in the field of medicine, including the treatment of inflammatory and neurodegenerative diseases, as well as viral infections. Further research on this protein could potentially lead to the development of novel and effective therapies for these diseases.

Recombinant Human TAX1BP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TAX1BP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products