Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human B4GALT6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UBX8
Molecular weight:
32.93 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Glu125–Tyr382
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human B4GALT6 Protein, N-His

Product name ARO-P11173-100
Uniprot ID Q9UBX8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu125-Tyr382
Aliases /Synonyms b4Gal-T6, Beta4Gal-T6, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6, Beta-1,4-galactosyltransferase 6, Lactosylceramide synthase, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, Beta-1,4-GalTase 6, Glucosylceramide beta-1,4-galactosyltransferase, LacCer synthase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, B4GALT6
Reference ARO-P11173
Note For research use only.
Molecular Constructor
Glu125–Tyr382
Product name ARO-P11173-1MG
Uniprot ID Q9UBX8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu125-Tyr382
Aliases /Synonyms b4Gal-T6, Beta4Gal-T6, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6, Beta-1,4-galactosyltransferase 6, Lactosylceramide synthase, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, Beta-1,4-GalTase 6, Glucosylceramide beta-1,4-galactosyltransferase, LacCer synthase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, B4GALT6
Reference ARO-P11173
Note For research use only.
Molecular Constructor
Glu125–Tyr382
Product name ARO-P11173-50
Uniprot ID Q9UBX8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu125-Tyr382
Aliases /Synonyms b4Gal-T6, Beta4Gal-T6, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6, Beta-1,4-galactosyltransferase 6, Lactosylceramide synthase, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, Beta-1,4-GalTase 6, Glucosylceramide beta-1,4-galactosyltransferase, LacCer synthase, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, B4GALT6
Reference ARO-P11173
Note For research use only.
Molecular Constructor
Glu125–Tyr382

Introduction to Recombinant Human B4GALT6 Protein

Recombinant human B4GALT6 protein, also known as beta-1,4-galactosyltransferase 6, is a glycosyltransferase enzyme that plays a crucial role in the biosynthesis of complex glycoproteins. This protein is encoded by the B4GALT6 gene and is involved in the transfer of galactose residues from UDP-galactose to N-acetylglucosamine (GlcNAc) residues on glycoproteins. The recombinant form of this protein is produced through genetic engineering techniques and has numerous applications in the field of biotechnology and medicine.

Structure of Recombinant Human B4GALT6 Protein

The recombinant human B4GALT6 protein is a 413 amino acid long polypeptide with a molecular weight of approximately 47 kDa. It contains a conserved catalytic domain and a C-terminal transmembrane domain. The catalytic domain consists of a GT-A fold, which is a common structural motif found in glycosyltransferases. This domain is responsible for the transfer of galactose from UDP-galactose to the acceptor substrate. The transmembrane domain anchors the protein to the endoplasmic reticulum, where it carries out its function in glycosylation.

Activity of Recombinant Human B4GALT6 Protein

The primary function of recombinant human B4GALT6 protein is to catalyze the addition of galactose residues to glycoproteins, a process known as galactosylation. This enzymatic activity is essential for the proper folding and function of glycoproteins, as well as for their recognition by other molecules in the body. B4GALT6 is highly specific for N-acetylglucosamine (GlcNAc) residues, which are found on the core structure of many glycoproteins. By adding galactose to these residues, B4GALT6 contributes to the diversity and complexity of glycoproteins, which are involved in various biological processes such as cell signaling, immune response, and cell adhesion.

In addition to its role in galactosylation, recombinant human B4GALT6 protein has also been shown to have sialyltransferase activity. This means that it can also transfer sialic acid residues to glycoproteins, further increasing the diversity of glycoprotein structures. Sialylation is important for the stability and function of glycoproteins, and deficiencies in this process have been linked to various diseases.

Application of Recombinant Human B4GALT6 Protein

The recombinant form of B4GALT6 has a wide range of applications in both research and medicine. One of the main uses of this protein is in the study of glycosylation and its role in various biological processes. By manipulating the expression or activity of B4GALT6, researchers can investigate the effects of glycosylation on different cellular functions and disease states. In addition, recombinant B4GALT6 can be used to produce glycoproteins with specific glycan structures, which can be used as tools for studying protein-protein interactions and as potential therapeutic agents.

Recombinant human B4GALT6 protein also has potential clinical applications. Mutations in the B4GALT6 gene have been associated with a rare genetic disorder called Ehlers-Danlos syndrome progeroid type 2 (EDS-P2). This syndrome is characterized by a range of symptoms including joint hypermobility, skin hyperextensibility, and premature aging. Studies have shown that recombinant B4GALT6 protein can correct the abnormal glycosylation patterns observed in EDS-P2 patients, providing a potential therapeutic approach for this disease.

Furthermore, recombinant B4GALT6

Recombinant Human B4GALT6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human B4GALT6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products