Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FBLN7, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53RD9
Molecular weight:
31.95 kDa

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Gly165–Phe439
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FBLN7, N-His

Product name ARO-P13308-100
Uniprot ID Q53RD9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Molecular weight 31.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly165-Phe439
Aliases /Synonyms FBLN7, TM14, FIBL-7, Fibulin-7
Reference ARO-P13308
Note For research use only.
Molecular Constructor
Gly165–Phe439
Product name ARO-P13308-1MG
Uniprot ID Q53RD9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Molecular weight 31.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly165-Phe439
Aliases /Synonyms FBLN7, TM14, FIBL-7, Fibulin-7
Reference ARO-P13308
Note For research use only.
Molecular Constructor
Gly165–Phe439
Product name ARO-P13308-50
Uniprot ID Q53RD9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Molecular weight 31.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly165-Phe439
Aliases /Synonyms FBLN7, TM14, FIBL-7, Fibulin-7
Reference ARO-P13308
Note For research use only.
Molecular Constructor
Gly165–Phe439

Introduction

Recombinant Human FBLN7, also known as Fibulin-7, is a protein that plays a crucial role in various biological processes. It is a member of the fibulin family of extracellular matrix proteins and is encoded by the FBLN7 gene. This protein has gained significant attention in the scientific community due to its diverse functions and potential applications in various fields. In this article, we will discuss the structure, activity, and applications of Recombinant Human FBLN7.

Structure of Recombinant Human FBLN7

Recombinant Human FBLN7 is a 66 kDa protein that is composed of 583 amino acids. It consists of an N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain contains 8 tandem repeats of epidermal growth factor (EGF)-like domains, while the central domain contains 5 tandem repeats of calcium-binding EGF-like domains. The C-terminal domain contains a fibulin-type C-terminal domain. These domains are responsible for the diverse functions of FBLN7.

Activity of Recombinant Human FBLN7

Recombinant Human FBLN7 has been shown to have various activities in different biological processes. One of its main functions is its role in cell adhesion and migration. It has been found to interact with integrins, which are cell surface receptors involved in cell adhesion. This interaction promotes cell adhesion and migration, which is important for processes such as wound healing and tissue regeneration.

FBLN7 also plays a role in the regulation of angiogenesis, the formation of new blood vessels. It has been shown to inhibit angiogenesis by binding to vascular endothelial growth factor (VEGF) and preventing its interaction with its receptor. This activity makes FBLN7 a potential therapeutic target for diseases where angiogenesis is dysregulated, such as cancer.

Another important activity of FBLN7 is its role in bone development and homeostasis. It has been shown to interact with bone morphogenetic proteins (BMPs), which are essential for bone formation. FBLN7 enhances the activity of BMPs and promotes bone formation, making it a potential therapeutic agent for bone-related disorders.

Applications of Recombinant Human FBLN7

Recombinant Human FBLN7 has a wide range of potential applications in various fields. One of its main applications is in the field of regenerative medicine. Its ability to promote cell adhesion and migration makes it a promising candidate for tissue engineering and wound healing. It can be incorporated into scaffolds or used as a coating for medical devices to enhance cell attachment and promote tissue regeneration.

In the field of cancer research, FBLN7 has shown potential as a therapeutic target for inhibiting angiogenesis. Its ability to bind to VEGF and prevent its interaction with its receptor makes it a potential anti-angiogenic agent. It can also be used in combination with other anti-angiogenic drugs to enhance their efficacy.

Furthermore, FBLN7 has potential applications in the field of bone disorders. Its ability to enhance the activity of BMPs and promote bone formation makes it a potential therapeutic agent for diseases such as osteoporosis and bone fractures. It can also be used in tissue engineering approaches to promote bone regeneration.

Conclusion

In summary, Recombinant Human FBLN7 is a versatile protein with diverse functions and potential applications in various fields. Its structure, activity, and potential applications make it a promising candidate for further research and development. With ongoing studies and advancements in recombinant protein technology, the potential of FBLN7 in various fields is only beginning to be explored.

Recombinant Human FBLN7, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FBLN7, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products