Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human F8/Coagulation factor VIII Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P00451
Molecular weight:
26 kDa

Original price was: €222.00.Current price is: €188.00.

50ug 15% OFF + 188 loyalty points
Val2144–Tyr2351
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human F8/Coagulation factor VIII Protein, N-His

Product name ARO-P10840-100
Uniprot ID P00451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Molecular weight 26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2144-Tyr2351
Aliases /Synonyms Coagulation factor VIII, Antihemophilic factor, AHF, Procoagulant component, Factor VIIIa heavy chain, 200 kDa isoform, Factor VIIIa heavy chain, 92 kDa isoform, Factor VIII B chain, Factor VIIIa light chain, F8, F8C
Reference ARO-P10840
Note For research use only.
Molecular Constructor
Val2144–Tyr2351
Product name ARO-P10840-1MG
Uniprot ID P00451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Molecular weight 26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2144-Tyr2351
Aliases /Synonyms Coagulation factor VIII, Antihemophilic factor, AHF, Procoagulant component, Factor VIIIa heavy chain, 200 kDa isoform, Factor VIIIa heavy chain, 92 kDa isoform, Factor VIII B chain, Factor VIIIa light chain, F8, F8C
Reference ARO-P10840
Note For research use only.
Molecular Constructor
Val2144–Tyr2351
Product name ARO-P10840-50
Uniprot ID P00451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Molecular weight 26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2144-Tyr2351
Aliases /Synonyms Coagulation factor VIII, Antihemophilic factor, AHF, Procoagulant component, Factor VIIIa heavy chain, 200 kDa isoform, Factor VIIIa heavy chain, 92 kDa isoform, Factor VIII B chain, Factor VIIIa light chain, F8, F8C
Reference ARO-P10840
Note For research use only.
Molecular Constructor
Val2144–Tyr2351

Introduction

Recombinant Human F8/Coagulation factor VIII Protein, N-His is a highly important therapeutic target in the treatment of hemophilia A, a genetic bleeding disorder caused by a deficiency in factor VIII. This protein is essential for blood clotting and its deficiency can lead to severe bleeding episodes. In this article, we will provide a scientific description of the structure, activity, and application of Recombinant Human F8/Coagulation factor VIII Protein, N-His.

Structure of Recombinant Human F8/Coagulation factor VIII Protein, N-His

Recombinant Human F8/Coagulation factor VIII Protein, N-His is a glycoprotein with a molecular weight of approximately 330 kDa. It is composed of 2332 amino acids and has a complex structure consisting of multiple domains and subunits. The protein is encoded by the F8 gene located on the X chromosome and is primarily produced in the liver.
The structure of Recombinant Human F8/Coagulation factor VIII Protein, N-His is divided into six domains, A1-A2-B-A3-C1-C2. The A domains are responsible for binding to von Willebrand factor (vWF), a protein that helps stabilize factor VIII in the blood. The B domain is a flexible linker region that connects the A and C domains. The C domains are responsible for binding to phospholipids and activating factor X, an essential step in the blood clotting process. The N-terminal region of the protein contains a histidine (His) tag, which is used for purification and detection purposes.

Activity of Recombinant Human F8/Coagulation factor VIII Protein, N-His

The primary function of Recombinant Human F8/Coagulation factor VIII Protein, N-His is to act as a co-factor in the blood clotting cascade. When a blood vessel is damaged, factor VIII is activated and helps to form a stable blood clot. This is achieved through its interaction with vWF and phospholipids, which leads to the activation of factor X. Deficiency in factor VIII activity results in impaired blood clotting, leading to prolonged bleeding and increased risk of hemorrhage.
Recombinant Human F8/Coagulation factor VIII Protein, N-His is also involved in other physiological processes, such as angiogenesis and cell signaling. Studies have shown that factor VIII plays a role in promoting the growth of new blood vessels, which is important for wound healing and tissue repair. It has also been implicated in regulating the activity of certain growth factors and cytokines, indicating its potential role in cell signaling pathways.

Application of Recombinant Human F8/Coagulation factor VIII Protein, N-His

Recombinant Human F8/Coagulation factor VIII Protein, N-His is primarily used as a therapeutic agent for the treatment of hemophilia A. The protein is produced using recombinant DNA technology and is identical to the natural form of factor VIII found in the body. It is administered intravenously to patients with hemophilia A to replace the missing or defective factor VIII, thereby restoring the blood clotting process and preventing bleeding episodes.
Besides its therapeutic use, Recombinant Human F8/Coagulation factor VIII Protein, N-His also has research applications. Scientists use this protein to study the structure and function of factor VIII and its role in blood clotting. It is also used in the development and testing of new treatments for hemophilia A and other bleeding disorders.

Conclusion

Recombinant Human F8/Coagulation factor VIII Protein, N-His is a crucial therapeutic target in the treatment of hemophilia A. Its complex structure and multiple functions make it a highly versatile protein with both therapeutic and research applications.

Recombinant Human F8/Coagulation factor VIII Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human F8/Coagulation factor VIII Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products