Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EWSR1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01844
Molecular weight:
22.71 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Asp353–Arg446
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EWSR1 Protein, N-His-SUMO

Product name ARO-P11973-100
Uniprot ID Q01844
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLAR
Molecular weight 22.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp353-Arg446
Aliases /Synonyms RNA-binding protein EWS, EWS oncogene, EWS, EWSR1, Ewing sarcoma breakpoint region 1 protein
Reference ARO-P11973
Note For research use only.
Molecular Constructor
Asp353–Arg446
Product name ARO-P11973-1MG
Uniprot ID Q01844
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLAR
Molecular weight 22.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp353-Arg446
Aliases /Synonyms RNA-binding protein EWS, EWS oncogene, EWS, EWSR1, Ewing sarcoma breakpoint region 1 protein
Reference ARO-P11973
Note For research use only.
Molecular Constructor
Asp353–Arg446
Product name ARO-P11973-50
Uniprot ID Q01844
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLAR
Molecular weight 22.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp353-Arg446
Aliases /Synonyms RNA-binding protein EWS, EWS oncogene, EWS, EWSR1, Ewing sarcoma breakpoint region 1 protein
Reference ARO-P11973
Note For research use only.
Molecular Constructor
Asp353–Arg446

Introduction

Recombinant Human EWSR1 Protein, also known as Ewing Sarcoma breakpoint region 1 protein, is a key component of the Ewing Sarcoma family of proteins. It plays a crucial role in regulating gene expression and is involved in a variety of cellular processes such as transcription, RNA processing, and DNA repair. This protein is highly conserved across species and is essential for normal cellular function. In this article, we will discuss the structure, activity, and application of Recombinant Human EWSR1 Protein.

Structure of Recombinant Human EWSR1 Protein

Recombinant Human EWSR1 Protein is a 68 kDa protein consisting of 656 amino acids. It is composed of three main domains – an N-terminal domain, a central RNA-binding domain, and a C-terminal domain. The N-terminal domain contains a transcriptional activation domain, which is responsible for regulating gene expression. The RNA-binding domain is responsible for binding to RNA and is essential for the function of EWSR1. The C-terminal domain is involved in protein-protein interactions and is responsible for the interaction of EWSR1 with other proteins.

Activity of Recombinant Human EWSR1 Protein

Recombinant Human EWSR1 Protein is a multifunctional protein that plays a crucial role in regulating gene expression. It is involved in a variety of cellular processes such as transcription, RNA processing, and DNA repair. EWSR1 has been shown to interact with a number of transcription factors, such as RNA polymerase II and TATA-binding protein, and regulate their activity. It also plays a role in the formation of the spliceosome, which is responsible for processing pre-mRNA into mature mRNA. EWSR1 has also been implicated in DNA repair, as it interacts with proteins involved in DNA damage response.

Application of Recombinant Human EWSR1 Protein

Recombinant Human EWSR1 Protein has a wide range of applications in the field of research and medicine. It is commonly used as an antigen in immunological studies, as it is highly immunogenic and can induce a strong immune response. This makes it a useful tool for the production of antibodies and the development of diagnostic tests for Ewing Sarcoma.

In addition, Recombinant Human EWSR1 Protein has been used in various studies to understand its role in gene expression and cellular processes. It has been shown to play a crucial role in the development and progression of Ewing Sarcoma, a rare type of bone cancer. Studies have also suggested its involvement in other types of cancer, making it a potential target for cancer therapy.

Furthermore, Recombinant Human EWSR1 Protein has been used in the development of new treatments for Ewing Sarcoma. It has been shown to be a potential target for small molecule inhibitors, which could potentially inhibit the growth of Ewing Sarcoma cells. This could lead to the development of more effective and targeted therapies for this type of cancer.

Conclusion

In conclusion, Recombinant Human EWSR1 Protein is a crucial component of the Ewing Sarcoma family of proteins. It is involved in a variety of cellular processes and plays a crucial role in regulating gene expression. Its structure and activity make it a valuable tool for research and medicine. With ongoing studies and research, Recombinant Human EWSR1 Protein has the potential to be a target for cancer therapy and the development of new treatments for Ewing Sarcoma.

Recombinant Human EWSR1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human EWSR1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products