Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human BCAS2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75934
Molecular weight:
28.29 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Met1–Phe225
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human BCAS2 Protein, N-His

Product name ARO-P11900-100
Uniprot ID O75934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular weight 28.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe225
Aliases /Synonyms DNA amplified in mammary carcinoma 1 protein, BCAS2, DAM1, Breast carcinoma-amplified sequence 2, Pre-mRNA-splicing factor SPF27, Spliceosome-associated protein SPF 27
Reference ARO-P11900
Note For research use only.
Molecular Constructor
Met1–Phe225
Product name ARO-P11900-1MG
Uniprot ID O75934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular weight 28.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe225
Aliases /Synonyms DNA amplified in mammary carcinoma 1 protein, BCAS2, DAM1, Breast carcinoma-amplified sequence 2, Pre-mRNA-splicing factor SPF27, Spliceosome-associated protein SPF 27
Reference ARO-P11900
Note For research use only.
Molecular Constructor
Met1–Phe225
Product name ARO-P11900-50
Uniprot ID O75934
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular weight 28.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe225
Aliases /Synonyms DNA amplified in mammary carcinoma 1 protein, BCAS2, DAM1, Breast carcinoma-amplified sequence 2, Pre-mRNA-splicing factor SPF27, Spliceosome-associated protein SPF 27
Reference ARO-P11900
Note For research use only.
Molecular Constructor
Met1–Phe225

Introduction

Recombinant proteins have become essential tools in various fields of research and medicine. These proteins are produced through genetic engineering techniques, where a specific gene is inserted into a host organism to produce large quantities of the desired protein. One such protein is the Recombinant Human BCAS2 Protein, which has gained attention for its unique structure, diverse activity, and potential applications.

Structure of Recombinant Human BCAS2 Protein

The BCAS2 gene encodes for a 401 amino acid protein, which is highly conserved among different species. The recombinant version of this protein is produced in E. coli or mammalian cells, with a molecular weight of approximately 45 kDa. The protein consists of several functional domains, including a nuclear localization signal, a transcriptional activation domain, and a DNA-binding domain. These domains play a crucial role in the protein’s activity and function.

Activity of Recombinant Human BCAS2 Protein

Recombinant Human BCAS2 Protein has been shown to have diverse activities in various cellular processes. One of its main functions is its role as a transcriptional coactivator, where it interacts with other proteins to enhance gene expression. It has also been reported to regulate cell proliferation and differentiation by modulating the activity of key signaling pathways, such as the Wnt/β-catenin pathway. Furthermore, studies have shown that BCAS2 plays a crucial role in DNA damage response and repair, making it a potential target for cancer therapy.

Application of Recombinant Human BCAS2 Protein

The unique structure and diverse activity of Recombinant Human BCAS2 Protein make it a valuable tool in various research and medical applications. One of its main uses is in studying gene regulation and transcriptional control. The protein’s ability to enhance gene expression makes it a useful tool in understanding the mechanisms of gene regulation and identifying potential therapeutic targets.

Moreover, Recombinant Human BCAS2 Protein has been studied for its potential role in cancer therapy. Its involvement in DNA damage response and repair pathways makes it a promising target for developing new treatments for cancer. Additionally, BCAS2 has been linked to drug resistance in certain types of cancer, making it a potential biomarker for predicting treatment response.

Furthermore, Recombinant Human BCAS2 Protein has been used in the development of diagnostic assays for various diseases. Its interaction with other proteins and its role in cell signaling pathways make it a potential biomarker for different diseases, including cancer and neurodegenerative disorders.

Conclusion

In summary, Recombinant Human BCAS2 Protein has a unique structure, diverse activity, and potential applications in various fields of research and medicine. Its role as a transcriptional coactivator, regulator of cell proliferation and differentiation, and involvement in DNA damage response and repair make it a valuable tool in understanding gene regulation and developing new treatments for diseases. With ongoing research and advancements in genetic engineering techniques, the use of Recombinant Human BCAS2 Protein is expected to expand, further contributing to the advancement of science and medicine.

Recombinant Human BCAS2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human BCAS2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products