Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ELAVL3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14576
Molecular weight:
20.91 kDa

Original price was: €265.00.Current price is: €230.00.

50ug 13% OFF + 230 loyalty points
Asp35–Ala203
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ELAVL3 Protein, N-His

Product name ARO-P11253-100
Uniprot ID Q14576
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA
Molecular weight 20.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp35-Ala203
Aliases /Synonyms HUC, Hu-antigen C, HuC, ELAV-like protein 3, ELAVL3, Paraneoplastic cerebellar degeneration-associated antigen, PLE21, Paraneoplastic limbic encephalitis antigen 21
Reference ARO-P11253
Note For research use only.
Molecular Constructor
Asp35–Ala203
Product name ARO-P11253-1MG
Uniprot ID Q14576
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA
Molecular weight 20.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp35-Ala203
Aliases /Synonyms HUC, Hu-antigen C, HuC, ELAV-like protein 3, ELAVL3, Paraneoplastic cerebellar degeneration-associated antigen, PLE21, Paraneoplastic limbic encephalitis antigen 21
Reference ARO-P11253
Note For research use only.
Molecular Constructor
Asp35–Ala203
Product name ARO-P11253-50
Uniprot ID Q14576
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA
Molecular weight 20.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp35-Ala203
Aliases /Synonyms HUC, Hu-antigen C, HuC, ELAV-like protein 3, ELAVL3, Paraneoplastic cerebellar degeneration-associated antigen, PLE21, Paraneoplastic limbic encephalitis antigen 21
Reference ARO-P11253
Note For research use only.
Molecular Constructor
Asp35–Ala203

Introduction to Recombinant Human ELAVL3 Protein

Recombinant Human ELAVL3 Protein, also known as ELAV-like protein 3, is a type of recombinant protein that plays a crucial role in various cellular processes. It is a member of the ELAV (embryonic lethal abnormal vision) family of RNA-binding proteins, which are known for their ability to regulate gene expression at the post-transcriptional level. In this article, we will explore the structure, activity, and applications of Recombinant Human ELAVL3 Protein.

Structure of Recombinant Human ELAVL3 Protein

The Recombinant Human ELAVL3 Protein is a 32 kDa protein consisting of 295 amino acids. It contains three RNA recognition motifs (RRMs) that are responsible for binding to specific RNA sequences. These RRMs are highly conserved in the ELAV family and are essential for their RNA-binding activity. The protein also has a nuclear localization signal, which allows it to be transported into the nucleus where it carries out its function.

The crystal structure of Recombinant Human ELAVL3 Protein has been determined and it reveals a compact protein with a globular shape. The three RRMs are arranged in a linear fashion, forming a groove that can accommodate the target RNA molecule. The structure also shows that the protein has a flexible C-terminal region, which is important for its RNA-binding activity.

Activity of Recombinant Human ELAVL3 Protein

Recombinant Human ELAVL3 Protein is primarily known for its role in regulating mRNA stability and translation. It binds to specific sequences in the 3′ untranslated region (UTR) of target mRNAs and protects them from degradation by ribonucleases. This allows the target mRNA to be translated into protein, leading to an increase in protein expression.

In addition to its role in mRNA stability, Recombinant Human ELAVL3 Protein also plays a role in alternative splicing. It has been shown to bind to pre-mRNA and influence the splicing process, resulting in the production of different protein isoforms. This activity is important for the regulation of gene expression and can have significant effects on cellular function.

Applications of Recombinant Human ELAVL3 Protein

The unique structure and activity of Recombinant Human ELAVL3 Protein make it a valuable tool in various research applications. Its ability to regulate mRNA stability and translation makes it an important factor in gene expression studies. Researchers can use this protein to manipulate the expression of specific genes and study their effects on cellular processes.

Recombinant Human ELAVL3 Protein is also used in alternative splicing studies. By manipulating its activity, researchers can investigate the effects of alternative splicing on protein function and cellular pathways. This can provide valuable insights into the role of alternative splicing in disease and other biological processes.

Furthermore, Recombinant Human ELAVL3 Protein has potential therapeutic applications. It has been shown to play a role in cancer progression, making it a potential target for cancer treatment. By understanding its structure and activity, researchers can develop drugs that can modulate its function and potentially inhibit cancer growth.

Conclusion

In summary, Recombinant Human ELAVL3 Protein is a versatile protein with a unique structure and activity. Its role in regulating mRNA stability and alternative splicing makes it a valuable tool in gene expression studies and has potential therapeutic applications. With ongoing research, we can continue to uncover the full potential of this protein and its impact on various cellular processes.

Recombinant Human ELAVL3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ELAVL3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products