Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human JPH3/JP-3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WXH2
Molecular weight:
18.04 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Met1–Ser147
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human JPH3/JP-3 Protein, N-His

Product name ARO-P11507-100
Uniprot ID Q8WXH2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQS
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser147
Aliases /Synonyms TNRC22, Junctophilin type 3, Junctophilin-3, JP3, JPH3, Trinucleotide repeat-containing gene 22 protein, JP-3
Reference ARO-P11507
Note For research use only.
Molecular Constructor
Met1–Ser147
Product name ARO-P11507-1MG
Uniprot ID Q8WXH2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQS
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser147
Aliases /Synonyms TNRC22, Junctophilin type 3, Junctophilin-3, JP3, JPH3, Trinucleotide repeat-containing gene 22 protein, JP-3
Reference ARO-P11507
Note For research use only.
Molecular Constructor
Met1–Ser147
Product name ARO-P11507-50
Uniprot ID Q8WXH2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQGYGVRQS
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser147
Aliases /Synonyms TNRC22, Junctophilin type 3, Junctophilin-3, JP3, JPH3, Trinucleotide repeat-containing gene 22 protein, JP-3
Reference ARO-P11507
Note For research use only.
Molecular Constructor
Met1–Ser147

Introduction to Recombinant Human JPH3/JP-3 Protein

Recombinant Human JPH3/JP-3 Protein, also known as junctophilin-3, is a protein that plays a crucial role in maintaining the structure and function of the cardiac muscle. It is a member of the junctophilin protein family and is primarily found in the junctional complexes of the heart, where it helps in the formation of the excitation-contraction coupling machinery. In this article, we will discuss the structure, activity, and applications of Recombinant Human JPH3/JP-3 Protein.

Structure of Recombinant Human JPH3/JP-3 Protein

The human JPH3/JP-3 gene is located on chromosome 16 and encodes for a protein of 696 amino acids. The protein has a predicted molecular weight of approximately 80 kDa and is composed of four major domains – a C-terminal transmembrane domain, a central coiled-coil domain, and two N-terminal amphipathic helix domains. The coiled-coil domain is responsible for the interaction of JPH3/JP-3 with other proteins, while the amphipathic helix domains are involved in the anchoring of the protein to the cell membrane.

Activity of Recombinant Human JPH3/JP-3 Protein

Recombinant Human JPH3/JP-3 Protein has been shown to play a crucial role in the formation and maintenance of the junctional complexes in the heart. These complexes are essential for the proper functioning of the cardiac muscle, as they facilitate the communication between the cell membrane and the sarcoplasmic reticulum. JPH3/JP-3 acts as a bridge between the two organelles, bringing them in close proximity and allowing for efficient calcium signaling, which is necessary for muscle contraction.

Moreover, JPH3/JP-3 has been found to interact with other proteins involved in the excitation-contraction coupling machinery, such as ryanodine receptors, voltage-gated calcium channels, and calsequestrin. These interactions are crucial for the proper functioning of the cardiac muscle and help in maintaining the balance of calcium ions within the cell.

Applications of Recombinant Human JPH3/JP-3 Protein

The primary application of Recombinant Human JPH3/JP-3 Protein is in the study of cardiac muscle function and disorders. Mutations in the JPH3/JP-3 gene have been linked to the development of hypertrophic cardiomyopathy, a condition characterized by thickening of the heart muscle, leading to impaired heart function. Recombinant Human JPH3/JP-3 Protein can be used to study the effects of these mutations on the structure and activity of the protein and its role in the development of the disease.

In addition, JPH3/JP-3 has also been found to be dysregulated in other cardiac disorders, such as heart failure and arrhythmias. Recombinant Human JPH3/JP-3 Protein can be used to investigate the role of JPH3/JP-3 in these conditions and potentially identify it as a therapeutic target.

Furthermore, Recombinant Human JPH3/JP-3 Protein has also been studied in the context of skeletal muscle function. It has been shown to play a role in the formation of the triad junctions, which are essential for the excitation-contraction coupling in skeletal muscle. Therefore, JPH3/JP-3 may have potential applications in the study of skeletal muscle disorders as well.

Conclusion

In conclusion, Recombinant Human JPH3/JP-3 Protein is a crucial protein involved in the formation and maintenance of junctional complexes in the heart. Its interactions with other proteins in the excitation-contraction coupling machinery make it essential for proper cardiac muscle function. The study of Recombinant Human JPH3/JP-3 Protein has potential applications in understanding and treating various cardiac and skeletal

Recombinant Human JPH3/JP-3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human JPH3/JP-3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products