Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EGFR/ERBB1/HER1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P00533
Molecular weight:
16.87 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Leu25–Ser151
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EGFR/ERBB1/HER1 Protein, N-His

Product name ARO-P10400-100
Uniprot ID P00533
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFS
Molecular weight 16.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu25-Ser151
Aliases /Synonyms HER1, Receptor tyrosine-protein kinase erbB-1, Proto-oncogene c-ErbB-1, Epidermal growth factor receptor, EGFR, ERBB1, ERBB
Reference ARO-P10400
Note For research use only.
Molecular Constructor
Leu25–Ser151
Product name ARO-P10400-1MG
Uniprot ID P00533
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFS
Molecular weight 16.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu25-Ser151
Aliases /Synonyms HER1, Receptor tyrosine-protein kinase erbB-1, Proto-oncogene c-ErbB-1, Epidermal growth factor receptor, EGFR, ERBB1, ERBB
Reference ARO-P10400
Note For research use only.
Molecular Constructor
Leu25–Ser151
Product name ARO-P10400-50
Uniprot ID P00533
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFS
Molecular weight 16.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu25-Ser151
Aliases /Synonyms HER1, Receptor tyrosine-protein kinase erbB-1, Proto-oncogene c-ErbB-1, Epidermal growth factor receptor, EGFR, ERBB1, ERBB
Reference ARO-P10400
Note For research use only.
Molecular Constructor
Leu25–Ser151

Introduction

Recombinant Human EGFR/ERBB1/HER1 Protein, also known as Epidermal Growth Factor Receptor, is a transmembrane protein that plays a crucial role in cell growth and proliferation. It is a member of the ErbB family of receptors and is activated by binding to its ligand, epidermal growth factor (EGF). This protein has been extensively studied and its structure, activity, and applications have been well characterized. In this article, we will provide a comprehensive overview of Recombinant Human EGFR/ERBB1/HER1 Protein, highlighting its structure, activity, and various applications in the field of biotechnology and medicine.

Structure of Recombinant Human EGFR/ERBB1/HER1 Protein

Recombinant Human EGFR/ERBB1/HER1 Protein is a 170-kDa transmembrane glycoprotein composed of 1186 amino acids. It consists of an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains four subdomains, namely I, II, III, and IV, which are responsible for ligand binding. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain contains a tyrosine kinase domain that is responsible for downstream signaling.

Activity of Recombinant Human EGFR/ERBB1/HER1 Protein

Recombinant Human EGFR/ERBB1/HER1 Protein is a receptor tyrosine kinase that is activated by binding to its ligand, EGF. Upon ligand binding, the receptor undergoes a conformational change, leading to the activation of its tyrosine kinase domain. This results in the autophosphorylation of specific tyrosine residues on the intracellular domain, which serves as docking sites for various downstream signaling molecules. These signaling pathways ultimately lead to cell proliferation, differentiation, and survival.

Applications of Recombinant Human EGFR/ERBB1/HER1 Protein

Recombinant Protein Production

Recombinant Human EGFR/ERBB1/HER1 Protein is widely used in the production of recombinant proteins. Its high affinity for EGF allows for efficient purification of the protein using affinity chromatography. This makes it an ideal choice for the production of recombinant proteins for various applications, including drug discovery and development.

Antigen for Antibody Production

Recombinant Human EGFR/ERBB1/HER1 Protein is also used as an antigen for the production of antibodies. Due to its role in cell proliferation and its overexpression in various cancers, it has been extensively studied as a potential target for cancer therapy. Antibodies against this protein have been developed and are used for diagnostic and therapeutic purposes in cancer treatment.

Cancer Research

Recombinant Human EGFR/ERBB1/HER1 Protein is a crucial tool in cancer research. Its overexpression has been linked to various types of cancer, including lung, breast, and colorectal cancer. Recombinant protein is used to study the mechanisms of EGFR signaling in cancer cells and to develop targeted therapies for these cancers. It is also used in preclinical studies to evaluate the efficacy of potential anti-cancer drugs.

Drug Development

Recombinant Human EGFR/ERBB1/HER1 Protein has been a target for drug development due to its role in cancer and other diseases. Several drugs have been developed that target this protein, including monoclonal antibodies and tyrosine kinase inhibitors. These drugs have shown promising results in clinical trials and have been approved for the treatment of various cancers, such as non-small cell lung cancer and metastatic colorectal cancer.

Diagnostic Applications

Recombinant Human EGFR

Recombinant Human EGFR/ERBB1/HER1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EGFR/ERBB1/HER1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products