Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CLDN5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O00501
Molecular weight:
34.42 kDa

Original price was: €258.00.Current price is: €230.00.

50ug 11% OFF + 230 loyalty points
Gly26–Arg81
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CLDN5 Protein, N-GST & C-His

Product name ARO-P11361-100
Uniprot ID O00501
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly26-Arg81
Aliases /Synonyms AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-P11361
Note For research use only.
Molecular Constructor
Gly26–Arg81
Product name ARO-P11361-1MG
Uniprot ID O00501
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly26-Arg81
Aliases /Synonyms AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-P11361
Note For research use only.
Molecular Constructor
Gly26–Arg81
Product name ARO-P11361-50
Uniprot ID O00501
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly26-Arg81
Aliases /Synonyms AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-P11361
Note For research use only.
Molecular Constructor
Gly26–Arg81

Recombinant Human CLDN5 Protein: Structure, Activity and Application

Introduction

Recombinant Human CLDN5 Protein is a type of recombinant protein that has been produced using genetic engineering techniques. It is a member of the claudin family of proteins, which are integral membrane proteins involved in the formation of tight junctions in epithelial and endothelial cells. CLDN5 is specifically found in the endothelial cells of the blood-brain barrier, making it an important target for research in neurobiology and drug delivery.

Structure of Recombinant Human CLDN5 Protein

The structure of Recombinant Human CLDN5 Protein is similar to that of other claudin family members. It consists of four transmembrane domains, two extracellular loops, and a cytoplasmic tail. The extracellular loops are responsible for forming tight junctions with adjacent cells, while the cytoplasmic tail interacts with intracellular proteins to regulate the permeability of the tight junctions.

Recombinant Human CLDN5 Protein is produced in a soluble form, making it easier to purify and study compared to its native membrane-bound form. It is typically expressed in mammalian cells, such as HEK293 cells, and purified using affinity chromatography. The resulting protein is highly pure and stable, making it suitable for various applications.

Activity of Recombinant Human CLDN5 Protein

The main function of CLDN5 is to regulate the paracellular transport of molecules across the blood-brain barrier. This is achieved by forming tight junctions with other endothelial cells, creating a physical barrier that restricts the movement of substances between the blood and the brain. Recombinant Human CLDN5 Protein has been shown to form functional tight junctions when expressed in endothelial cells, indicating its ability to regulate paracellular transport.

In addition to its role in the blood-brain barrier, CLDN5 has also been implicated in other physiological processes such as cell proliferation, migration, and differentiation. Studies have shown that alterations in CLDN5 expression can affect the permeability of tight junctions, leading to changes in cell behavior. This highlights the importance of CLDN5 in maintaining the integrity and function of various tissues and organs.

Applications of Recombinant Human CLDN5 Protein

The unique properties of Recombinant Human CLDN5 Protein make it a valuable tool for research in various fields, including neurobiology, drug delivery, and tissue engineering. By studying the structure and activity of CLDN5, researchers can gain a better understanding of the blood-brain barrier and its role in disease and drug delivery to the brain.

One potential application of Recombinant Human CLDN5 Protein is in the development of drugs that can target the blood-brain barrier. As CLDN5 is specifically expressed in the endothelial cells of the blood-brain barrier, it can serve as a target for drug delivery systems that can cross this barrier. By incorporating CLDN5-targeting molecules into drug carriers, researchers can potentially improve the delivery of therapeutics to the brain.

Furthermore, Recombinant Human CLDN5 Protein can also be used in tissue engineering to create artificial blood-brain barrier models for drug screening and disease modeling. By culturing endothelial cells expressing CLDN5 on a porous membrane, researchers can mimic the structure and function of the blood-brain barrier and study its response to different compounds or diseases.

Conclusion

In summary, Recombinant Human CLDN5 Protein is a valuable tool for research in neurobiology, drug delivery, and tissue engineering. Its unique structure and activity make it an important target for understanding the

Recombinant Human CLDN5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CLDN5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products