Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CLDN5/Claudin-5 Antibody (M11), PerCP

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Target species:
Human, Monkey
Clone Name:
M11

Original price was: €404.00.Current price is: €326.00.

50ug 19% OFF + 326 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CLDN5/Claudin-5 Antibody (M11), PerCP

Product name ARO-A10245-100
Uniprot ID O00501
Raw Antigen Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-A10245
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Clone Name M11
Target species Human, Monkey
Product name ARO-A10245-1MG
Uniprot ID O00501
Raw Antigen Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-A10245
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Clone Name M11
Target species Human, Monkey
Product name ARO-A10245-50
Uniprot ID O00501
Raw Antigen Sequence MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Reference ARO-A10245
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target AWAL, Transmembrane protein deleted in VCFS, TMVCF, TMDVCF, Claudin-5, CLDN5
Clone Name M11
Target species Human, Monkey

There are no reviews yet.

Be the first to review “Anti-Human CLDN5/Claudin-5 Antibody (M11), PerCP”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products