Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q69YH5
Molecular weight:
34.72 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Ala383–Glu441
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA2 Protein, N-GST & C-His

Product name ARO-P11301-100
Uniprot ID Q69YH5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPE
Molecular weight 34.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala383-Glu441
Aliases /Synonyms Repo-Man, Recruits PP1 onto mitotic chromatin at anaphase protein, CDCA2, Cell division cycle-associated protein 2
Reference ARO-P11301
Note For research use only.
Molecular Constructor
Ala383–Glu441
Product name ARO-P11301-1MG
Uniprot ID Q69YH5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPE
Molecular weight 34.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala383-Glu441
Aliases /Synonyms Repo-Man, Recruits PP1 onto mitotic chromatin at anaphase protein, CDCA2, Cell division cycle-associated protein 2
Reference ARO-P11301
Note For research use only.
Molecular Constructor
Ala383–Glu441
Product name ARO-P11301-50
Uniprot ID Q69YH5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPE
Molecular weight 34.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala383-Glu441
Aliases /Synonyms Repo-Man, Recruits PP1 onto mitotic chromatin at anaphase protein, CDCA2, Cell division cycle-associated protein 2
Reference ARO-P11301
Note For research use only.
Molecular Constructor
Ala383–Glu441

Introduction

Recombinant Human CDCA2 Protein, also known as Cell Division Cycle Associated 2, is a protein that plays a crucial role in regulating cell division and proliferation. This protein is encoded by the CDCA2 gene and is found in humans and other mammals. Recombinant Human CDCA2 Protein is produced using recombinant DNA technology and has numerous applications in the fields of medicine and biotechnology.

Structure of Recombinant Human CDCA2 Protein

Recombinant Human CDCA2 Protein is a 37 kDa protein consisting of 333 amino acids. It contains a conserved N-terminal domain and a C-terminal domain, both of which are essential for its function. The N-terminal domain is responsible for binding to other proteins, while the C-terminal domain is involved in regulating cell division.

Activity of Recombinant Human CDCA2 Protein

Recombinant Human CDCA2 Protein is involved in the regulation of the cell cycle, specifically the G2/M transition phase. It interacts with other proteins, such as cyclin-dependent kinases, to ensure proper progression through the cell cycle. It also plays a role in maintaining genomic stability and preventing abnormal cell division.

Applications of Recombinant Human CDCA2 Protein

Recombinant Human CDCA2 Protein has numerous applications in the fields of medicine and biotechnology. Some of these applications include:

1. Cancer Research

Recombinant Human CDCA2 Protein is a potential target for cancer therapy. Its overexpression has been observed in various types of cancer, including breast, lung, and colon cancer. By understanding its role in regulating cell division, researchers can develop targeted therapies to inhibit its activity and prevent cancer growth.

2. Cell Biology

Recombinant Human CDCA2 Protein is widely used in cell biology research to study the cell cycle and its regulation. Its role in the G2/M transition phase makes it a crucial protein for understanding cell division and proliferation. By studying its interactions with other proteins, researchers can gain insights into the mechanisms of cell division.

3. Drug Development

Recombinant Human CDCA2 Protein is also a potential target for drug development. By inhibiting its activity, researchers can develop drugs that can prevent abnormal cell division and proliferation, which is a hallmark of cancer. This protein can also be used as a biomarker for drug efficacy in clinical trials.

4. Diagnostic Tool

Recombinant Human CDCA2 Protein can be used as a diagnostic tool for cancer. Its overexpression in cancer cells makes it a potential biomarker for early detection and diagnosis of cancer. By detecting elevated levels of this protein, doctors can identify the presence of cancer and start treatment early.

5. Vaccine Development

Recombinant Human CDCA2 Protein can also be used in vaccine development. By using this protein as an antigen, researchers can develop vaccines that can induce an immune response against cancer cells. This approach is known as cancer immunotherapy and has shown promising results in clinical trials.

Conclusion

Recombinant Human CDCA2 Protein is a crucial protein involved in regulating cell division and proliferation. Its structure and activity make it a potential target for cancer therapy and drug development. It also has applications in cell biology, diagnostic tools, and vaccine development. With ongoing research, this protein has the potential to revolutionize cancer treatment and improve patient outcomes.

Recombinant Human CDCA2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CDCA2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products