Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP1B2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P14415
Molecular weight:
26.14 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Gly81–Thr290
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP1B2 Protein, N-His

Product name ARO-P11857-100
Uniprot ID P14415
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Molecular weight 26.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly81-Thr290
Aliases /Synonyms ATP1B2, Adhesion molecule in glia, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2, AMOG
Reference ARO-P11857
Note For research use only.
Molecular Constructor
Gly81–Thr290
Product name ARO-P11857-1MG
Uniprot ID P14415
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Molecular weight 26.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly81-Thr290
Aliases /Synonyms ATP1B2, Adhesion molecule in glia, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2, AMOG
Reference ARO-P11857
Note For research use only.
Molecular Constructor
Gly81–Thr290
Product name ARO-P11857-50
Uniprot ID P14415
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Molecular weight 26.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly81-Thr290
Aliases /Synonyms ATP1B2, Adhesion molecule in glia, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2, AMOG
Reference ARO-P11857
Note For research use only.
Molecular Constructor
Gly81–Thr290

Introduction

Recombinant Human ATP1B2 Protein, also known as Sodium/Potassium-transporting ATPase subunit beta-2, is a protein that plays a crucial role in maintaining the balance of sodium and potassium ions in cells. This protein is encoded by the ATP1B2 gene and is a member of the ATPase family of proteins.

Structure of Recombinant Human ATP1B2 Protein

The Recombinant Human ATP1B2 Protein is composed of 302 amino acids with a molecular weight of approximately 33 kDa. It is a transmembrane protein that consists of two subunits – alpha and beta. The alpha subunit is responsible for the catalytic activity of the protein, while the beta subunit is involved in regulating the activity and stability of the alpha subunit.

The beta subunit of the Recombinant Human ATP1B2 Protein contains a large extracellular domain, a single transmembrane domain, and a small cytoplasmic domain. The extracellular domain is glycosylated and contains binding sites for sodium, potassium, and ATP. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic domain interacts with the alpha subunit and other regulatory proteins.

Function of Recombinant Human ATP1B2 Protein

The main function of Recombinant Human ATP1B2 Protein is to maintain the electrochemical gradient of sodium and potassium ions across the cell membrane. This is essential for various cellular processes such as nerve conduction, muscle contraction, and nutrient uptake.

The alpha subunit of the protein uses energy from ATP to transport three sodium ions out of the cell and two potassium ions into the cell. This process is crucial for maintaining the resting membrane potential of cells and for generating action potentials in nerve and muscle cells.

The beta subunit of the Recombinant Human ATP1B2 Protein plays a regulatory role by modulating the activity of the alpha subunit. It also helps in targeting the protein to specific locations in the cell and in maintaining its stability.

Application of Recombinant Human ATP1B2 Protein

Recombinant Human ATP1B2 Protein has a wide range of applications in both research and therapeutic settings.

In research, this protein is used as an antigen in various studies related to ion transport, membrane proteins, and neurological disorders. It is also used in drug discovery and development, as aberrations in the function of this protein have been linked to several diseases, including hypertension, diabetes, and neurological disorders.

In therapeutic applications, Recombinant Human ATP1B2 Protein is being investigated as a potential target for the treatment of diseases such as hypertension and epilepsy. It is also being studied for its potential role in drug resistance in cancer cells.

Conclusion

In summary, Recombinant Human ATP1B2 Protein is a crucial protein involved in maintaining the balance of sodium and potassium ions across the cell membrane. Its structure, function, and applications make it a valuable protein for both research and therapeutic purposes. Further studies on this protein may lead to a better understanding of its role in various diseases and the development of new treatments.

Recombinant Human ATP1B2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ATP1B2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products