Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enavatuzumab Biosimilar – Anti-TNFRSF12A, CD266 mAb – Research Grade

  • PX-TA1253-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade

Product name Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade
Uniprot ID Q9NP84
Source CAS 1062149-33-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Enavatuzumab,PDL 192,TNFRSF12A, CD266,anti-TNFRSF12A, CD266
Reference PX-TA1253
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade
Uniprot ID Q9NP84
Source CAS 1062149-33-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Enavatuzumab,PDL 192,TNFRSF12A, CD266,anti-TNFRSF12A, CD266
Reference PX-TA1253
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1253-50
Uniprot ID Q9NP84
Source CAS 1062149-33-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Enavatuzumab,PDL 192,TNFRSF12A, CD266,anti-TNFRSF12A, CD266
Reference PX-TA1253
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-TNFRSF12A/CD266[Homo sapiens] (Enavatuzumab) Monoclonal Antibody

Enavatuzumab is a humanized monoclonal antibody that targets the TWEAK receptor. It has been investigated for the treatment of cancers.

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade in WB Assay

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade in WB Assay

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

SEC-HPLC of Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade

SEC-HPLC of Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade

There are no reviews yet.

Be the first to review “Enavatuzumab Biosimilar – Anti-TNFRSF12A, CD266 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products