Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL1RAP, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NPH3
Molecular weight:
23.63 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Gly65–Asn249
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL1RAP, N-His

Product name ARO-P13075-100
Uniprot ID Q9NPH3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly65-Asn249
Aliases /Synonyms IL-1R3, C3orf13, Interleukin-1 receptor 3, Interleukin-1 receptor accessory protein, IL1RAP, IL-1R-3, IL-1 receptor accessory protein, IL1R3, IL-1RAcP
Reference ARO-P13075
Note For research use only.
Molecular Constructor
Gly65–Asn249
Product name ARO-P13075-1MG
Uniprot ID Q9NPH3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly65-Asn249
Aliases /Synonyms IL-1R3, C3orf13, Interleukin-1 receptor 3, Interleukin-1 receptor accessory protein, IL1RAP, IL-1R-3, IL-1 receptor accessory protein, IL1R3, IL-1RAcP
Reference ARO-P13075
Note For research use only.
Molecular Constructor
Gly65–Asn249
Product name ARO-P13075-50
Uniprot ID Q9NPH3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPN
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly65-Asn249
Aliases /Synonyms IL-1R3, C3orf13, Interleukin-1 receptor 3, Interleukin-1 receptor accessory protein, IL1RAP, IL-1R-3, IL-1 receptor accessory protein, IL1R3, IL-1RAcP
Reference ARO-P13075
Note For research use only.
Molecular Constructor
Gly65–Asn249

Introduction

Recombinant Human IL1RAP, also known as Interleukin 1 Receptor Accessory Protein, is a protein that plays a crucial role in the immune system. It is a soluble protein that is involved in the regulation of inflammation and immune responses. Recombinant Human IL1RAP is produced through recombinant DNA technology, making it a highly pure and biologically active protein. In this article, we will discuss the structure, activity, and applications of Recombinant Human IL1RAP.

Structure of Recombinant Human IL1RAP

Recombinant Human IL1RAP is a glycosylated protein with a molecular weight of approximately 70 kDa. It is composed of 618 amino acids and contains a signal peptide at the N-terminus, followed by three extracellular immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic domain. The extracellular domains are important for binding to its ligands, while the cytoplasmic domain is involved in signal transduction.

Activity of Recombinant Human IL1RAP

Recombinant Human IL1RAP is a co-receptor for the pro-inflammatory cytokines IL-1α and IL-1β. It works by binding to these cytokines and facilitating their interaction with the IL-1 receptor type I (IL-1RI). This interaction leads to the activation of downstream signaling pathways, resulting in the production of pro-inflammatory cytokines, chemokines, and other mediators of inflammation. Recombinant Human IL1RAP also plays a role in the activation of T cells and the differentiation of Th17 cells, which are important in the adaptive immune response.

Application of Recombinant Human IL1RAP

Recombinant Human IL1RAP has a wide range of applications in both research and clinical settings. Some of the key applications of this protein include:

1. Studying the role of IL1RAP in inflammation

Recombinant Human IL1RAP is commonly used in research to understand the role of this protein in inflammation and immune responses. It can be used to study the signaling pathways involved in IL1RAP-mediated inflammation and to investigate the effects of IL1RAP on different immune cells.

2. Development of therapeutic interventions for inflammatory diseases

Given its role in inflammation, Recombinant Human IL1RAP has potential as a therapeutic target for inflammatory diseases. Researchers are currently exploring the use of IL1RAP inhibitors for the treatment of conditions such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease.

3. Diagnostic tool for autoimmune diseases

Autoimmune diseases are characterized by an overactive immune response, and IL1RAP has been implicated in the development of these conditions. Recombinant Human IL1RAP can be used as a biomarker for autoimmune diseases, aiding in their diagnosis and management.

4. Production of antibodies for IL1RAP detection

Recombinant Human IL1RAP can be used to produce monoclonal and polyclonal antibodies for the detection of this protein. These antibodies can be used in techniques such as ELISA, Western blotting, and immunohistochemistry to study IL1RAP expression in different tissues and cells.

5. Potential as a vaccine adjuvant

IL1RAP has been shown to enhance the immune response to vaccines, making it a potential adjuvant for vaccine development. Recombinant Human IL1RAP can be used to study its adjuvant properties and to develop more effective vaccines.

Conclusion

Recombinant Human IL1RAP is a key protein involved in inflammation and immune responses. Its structure, activity, and applications make it a valuable tool for studying the immune system and developing therapeutic interventions for inflammatory diseases. With ongoing research, we can expect to uncover more about the role of Recombinant Human IL1RAP and its potential in various fields of medicine.

Recombinant Human IL1RAP, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL1RAP, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products