Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NGB, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NPG2
Molecular weight:
43.77 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Glu151
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NGB, N-GST

Product name ARO-P13077-100
Uniprot ID Q9NPG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular weight 43.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu151
Aliases /Synonyms NGB, Neuroglobin
Reference ARO-P13077
Note For research use only.
Molecular Constructor
Met1–Glu151
Product name ARO-P13077-1MG
Uniprot ID Q9NPG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular weight 43.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu151
Aliases /Synonyms NGB, Neuroglobin
Reference ARO-P13077
Note For research use only.
Molecular Constructor
Met1–Glu151
Product name ARO-P13077-50
Uniprot ID Q9NPG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Molecular weight 43.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu151
Aliases /Synonyms NGB, Neuroglobin
Reference ARO-P13077
Note For research use only.
Molecular Constructor
Met1–Glu151

Introduction

Recombinant Human NGB (Neuroglobin) is a novel protein that has gained significant attention in the scientific community due to its unique structure and potential therapeutic applications. It is a member of the globin family of proteins and is highly expressed in the nervous system, particularly in the brain and retina. In this article, we will discuss the structure, activity, and applications of Recombinant Human NGB.

Structure of Recombinant Human NGB

Recombinant Human NGB is a 151 amino acid protein with a molecular weight of approximately 17 kDa. It is composed of a single polypeptide chain that folds into a characteristic globin fold, consisting of eight alpha helices and a heme-binding pocket. The heme group is essential for the function of NGB as it allows for the binding and transport of oxygen.

Activity of Recombinant Human NGB

The primary function of Recombinant Human NGB is to bind and transport oxygen in the cells of the nervous system. It has a higher affinity for oxygen than other globins, such as hemoglobin and myoglobin, making it an efficient oxygen carrier. Additionally, NGB has been found to have neuroprotective properties, as it can scavenge reactive oxygen species and protect neurons from oxidative stress. It has also been shown to regulate cell death pathways and promote cell survival in various cellular models.

Applications of Recombinant Human NGB

The unique structure and activity of Recombinant Human NGB have led to its potential applications in various fields of medicine and research.

Therapeutic Applications

One of the most promising applications of Recombinant Human NGB is in the treatment of neurological disorders. Studies have shown that NGB levels are decreased in conditions such as stroke, Alzheimer’s disease, and Parkinson’s disease. By supplementing with Recombinant Human NGB, it may be possible to protect neurons and reduce the severity of these diseases. Furthermore, Recombinant Human NGB has been shown to have anti-inflammatory effects, making it a potential therapeutic agent for inflammatory conditions of the nervous system.

Diagnostic Applications

Recombinant Human NGB has also been explored as a potential biomarker for various neurological disorders. Changes in NGB levels have been observed in the cerebrospinal fluid of patients with traumatic brain injury, stroke, and neurodegenerative diseases. This makes it a potential diagnostic tool for these conditions, allowing for early detection and treatment.

Research Applications

In addition to its potential therapeutic and diagnostic applications, Recombinant Human NGB has also been widely used in research. It has been studied in various animal models to understand its role in neurological function and disease. Recombinant Human NGB has also been used in cell culture studies to investigate its protective effects and potential mechanisms of action.

Conclusion

In summary, Recombinant Human NGB is a unique protein with a characteristic globin fold and a heme-binding pocket. Its primary function is to bind and transport oxygen in the nervous system, but it also has neuroprotective properties. This makes it a promising candidate for the treatment of neurological disorders and a potential biomarker for their diagnosis. Additionally, Recombinant Human NGB has been widely used in research to further understand its role in the nervous system. With ongoing studies and advancements in technology, the potential applications of Recombinant Human NGB continue to expand, making it a promising protein for future medical and scientific discoveries.

Recombinant Human NGB, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human NGB, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products