Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ANO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5XXA6
Molecular weight:
26.90 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Met117–Gly325
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ANO1 Protein, N-His

Product name ARO-P11368-100
Uniprot ID Q5XXA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFG
Molecular weight 26.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met117-Gly325
Aliases /Synonyms Anoctamin-1, Tumor-amplified and overexpressed sequence 2, Transmembrane protein 16A, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, TMEM16A, ANO1, TAOS2, ORAOV2, DOG1
Reference ARO-P11368
Note For research use only.
Molecular Constructor
Met117–Gly325
Product name ARO-P11368-1MG
Uniprot ID Q5XXA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFG
Molecular weight 26.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met117-Gly325
Aliases /Synonyms Anoctamin-1, Tumor-amplified and overexpressed sequence 2, Transmembrane protein 16A, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, TMEM16A, ANO1, TAOS2, ORAOV2, DOG1
Reference ARO-P11368
Note For research use only.
Molecular Constructor
Met117–Gly325
Product name ARO-P11368-50
Uniprot ID Q5XXA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFG
Molecular weight 26.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met117-Gly325
Aliases /Synonyms Anoctamin-1, Tumor-amplified and overexpressed sequence 2, Transmembrane protein 16A, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, TMEM16A, ANO1, TAOS2, ORAOV2, DOG1
Reference ARO-P11368
Note For research use only.
Molecular Constructor
Met117–Gly325

Introduction

Recombinant Human ANO1 protein, also known as Anoctamin-1, is a calcium-activated chloride channel that is encoded by the ANO1 gene. This protein is expressed in various tissues, including the gastrointestinal tract, respiratory tract, and reproductive organs. It plays a crucial role in regulating chloride transport across cell membranes, which is essential for maintaining proper physiological functions. In this article, we will discuss the structure, activity, and applications of Recombinant Human ANO1 Protein.

Structure of Recombinant Human ANO1 Protein

The ANO1 gene encodes a protein of 940 amino acids, which undergoes post-translational modifications to form the functional ANO1 protein. The protein consists of eight transmembrane domains, with both the N- and C-termini located in the cytoplasm. The transmembrane domains are connected by intracellular and extracellular loops, which are important for channel gating and regulation. The protein also contains a large cytoplasmic domain, which is responsible for its calcium sensitivity.

Activity of Recombinant Human ANO1 Protein

Recombinant Human ANO1 protein is a calcium-activated chloride channel, which means it opens in response to an increase in intracellular calcium levels. This channel allows the flow of chloride ions out of the cell, which helps to maintain the electrical balance across the cell membrane. The activity of ANO1 protein is regulated by various factors, including pH, membrane potential, and phosphorylation. Dysregulation of ANO1 activity has been linked to various diseases, such as cystic fibrosis, hypertension, and cancer.

Applications of Recombinant Human ANO1 Protein

Recombinant Human ANO1 protein has several applications in both research and clinical settings. Here are some of the key applications of this protein:

1. Drug Development

As ANO1 protein plays a crucial role in various diseases, it has been identified as a potential therapeutic target. Recombinant Human ANO1 protein can be used in drug screening assays to identify compounds that can modulate its activity. This can lead to the development of new drugs for diseases such as cystic fibrosis, asthma, and hypertension.

2. Functional Studies

Recombinant Human ANO1 protein can also be used in functional studies to understand its role in different physiological processes. This can be achieved by overexpressing or silencing the ANO1 gene in cells and observing the effects on chloride transport and other cellular functions. These studies can provide valuable insights into the role of ANO1 in various diseases and potential therapeutic interventions.

3. Antibody Production

Recombinant Human ANO1 protein can be used as an antigen to produce specific antibodies for research and diagnostic purposes. These antibodies can be used to detect ANO1 expression in tissues and cells, as well as to study its localization and function.

4. Gene Therapy

Defects in the ANO1 gene have been linked to various diseases, making it a potential target for gene therapy. Recombinant Human ANO1 protein can be used to replace the defective protein in cells, restoring its function and potentially treating the disease.

5. Biomarker Discovery

Several studies have shown that ANO1 expression is altered in various cancers, making it a potential biomarker for cancer diagnosis and prognosis. Recombinant Human ANO1 protein can be used to develop diagnostic tests for these cancers, as well as to identify potential therapeutic targets.

Conclusion

In conclusion, Recombinant Human ANO1 protein is a crucial calcium-activated chloride channel with various physiological functions. Its structure and activity have been extensively studied, and it has several applications in drug development, functional studies, antibody production, gene therapy, and biomarker discovery. Further research on this protein can lead to a better understanding of its role in disease and the development of novel

Recombinant Human ANO1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ANO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products