Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GJB1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P08034
Molecular weight:
34.15 kDa

Original price was: €382.00.Current price is: €329.00.

100ug 14% OFF + 329 loyalty points
Arg215–Ser266
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GJB1 Protein, N-GST & C-His

Product name ARO-P10803-100
Uniprot ID P08034
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRS
Molecular weight 34.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg215-Ser266
Aliases /Synonyms GAP junction 28 kDa liver protein, Cx32, Connexin-32, Gap junction beta-1 protein, CX32, GJB1
Reference ARO-P10803
Note For research use only.
Molecular Constructor
Arg215–Ser266
Product name ARO-P10803-1MG
Uniprot ID P08034
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRS
Molecular weight 34.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg215-Ser266
Aliases /Synonyms GAP junction 28 kDa liver protein, Cx32, Connexin-32, Gap junction beta-1 protein, CX32, GJB1
Reference ARO-P10803
Note For research use only.
Molecular Constructor
Arg215–Ser266
Product name ARO-P10803-50
Uniprot ID P08034
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRS
Molecular weight 34.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg215-Ser266
Aliases /Synonyms GAP junction 28 kDa liver protein, Cx32, Connexin-32, Gap junction beta-1 protein, CX32, GJB1
Reference ARO-P10803
Note For research use only.
Molecular Constructor
Arg215–Ser266

Introduction

Recombinant Human GJB1 Protein, also known as Gap Junction Beta-1 Protein, is a type of recombinant protein that plays a crucial role in cell communication and function. This protein is produced through genetic engineering techniques and has a wide range of applications in the field of biotechnology and medicine.

Structure of Recombinant Human GJB1 Protein

The GJB1 gene, located on chromosome X, encodes the protein GJB1. This protein belongs to the connexin family, which consists of transmembrane proteins that form gap junctions between cells. The recombinant form of GJB1 protein is produced by inserting the GJB1 gene into a suitable expression vector and then expressing it in a host organism, such as bacteria or mammalian cells.

The recombinant GJB1 protein has a similar structure to its native form, consisting of four transmembrane domains, two extracellular loops, and one intracellular loop. It also has a conserved sequence of amino acids that are essential for its function as a gap junction protein.

Activity of Recombinant Human GJB1 Protein

The main function of GJB1 protein is to facilitate the exchange of small molecules and ions between adjacent cells through gap junctions. These gap junctions are specialized channels that allow for direct communication between cells, enabling the coordination of various cellular activities.

Recombinant Human GJB1 protein has been shown to be active in forming functional gap junctions when expressed in different cell types, such as HeLa cells and Xenopus oocytes. It has also been found to have similar activity to its native form, indicating its potential for use in various applications.

Applications of Recombinant Human GJB1 Protein

Recombinant Human GJB1 protein has a wide range of applications in both research and medicine.

1. Research

The use of recombinant GJB1 protein in research has greatly advanced our understanding of gap junctions and their role in cellular communication. It has also been used to study the effects of mutations in the GJB1 gene, which have been linked to various diseases such as Charcot-Marie-Tooth disease and X-linked Charcot-Marie-Tooth disease.

2. Drug Development

Gap junctions have been implicated in various diseases, making them potential targets for drug development. Recombinant GJB1 protein can be used to screen for compounds that can modulate the activity of gap junctions and potentially treat diseases associated with their dysfunction.

3. Tissue Engineering

Recombinant GJB1 protein has been used in tissue engineering to create functional gap junctions between cells, allowing for the formation of complex tissues and organs. This has potential applications in regenerative medicine and the development of artificial organs.

Conclusion

In summary, Recombinant Human GJB1 Protein is a crucial protein in cellular communication and function. Its production through genetic engineering techniques has allowed for its use in various research and medical applications. With ongoing advancements in biotechnology, the potential uses of this protein are continuously expanding, making it a valuable tool in the scientific community.

Recombinant Human GJB1 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human GJB1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products