Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SFTPB Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P07988
Molecular weight:
38.28 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Gly290–Leu381
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SFTPB Protein, N-GST & C-His

Product name ARO-P10802-100
Uniprot ID P07988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular weight 38.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly290-Leu381
Aliases /Synonyms Pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SP-B, SFTPB, SFTP3, 6 kDa protein, 18 kDa pulmonary-surfactant protein
Reference ARO-P10802
Note For research use only.
Molecular Constructor
Gly290–Leu381
Product name ARO-P10802-1MG
Uniprot ID P07988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular weight 38.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly290-Leu381
Aliases /Synonyms Pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SP-B, SFTPB, SFTP3, 6 kDa protein, 18 kDa pulmonary-surfactant protein
Reference ARO-P10802
Note For research use only.
Molecular Constructor
Gly290–Leu381
Product name ARO-P10802-50
Uniprot ID P07988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular weight 38.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly290-Leu381
Aliases /Synonyms Pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SP-B, SFTPB, SFTP3, 6 kDa protein, 18 kDa pulmonary-surfactant protein
Reference ARO-P10802
Note For research use only.
Molecular Constructor
Gly290–Leu381

Introduction

Recombinant Human SFTPB Protein, also known as surfactant protein B, is a vital component of the pulmonary surfactant complex that is essential for proper lung function. This protein is encoded by the SFTPB gene and is primarily produced in the alveolar type II cells of the lungs. The recombinant form of this protein is produced through genetic engineering techniques and has been extensively studied for its structure, activity, and potential applications in various diseases.

Structure of Recombinant Human SFTPB Protein

The recombinant form of SFTPB protein is a 79 amino acid polypeptide with a molecular weight of approximately 8.7 kDa. It is composed of a hydrophobic N-terminal region, a highly conserved central region, and a hydrophilic C-terminal region. This structure is similar to the native form of the protein found in humans and is essential for its proper function.

The hydrophobic N-terminal region of the protein is responsible for its interaction with other surfactant proteins and lipids, while the central region contains the highly conserved BRICHOS domain that is crucial for the proper folding and stability of the protein. The hydrophilic C-terminal region contains a proline-rich region that is involved in the binding of the protein to the lung surfactant lipid layer.

Activity of Recombinant Human SFTPB Protein

The primary function of SFTPB protein is to reduce the surface tension at the air-liquid interface in the lungs, allowing for proper gas exchange and preventing the collapse of alveoli. The recombinant form of this protein has been shown to have similar activity to the native form and is essential for maintaining proper lung function.

In addition to its role in surfactant function, SFTPB protein has also been found to have immunomodulatory properties. It has been shown to interact with immune cells and regulate their function, potentially playing a role in the body’s defense against respiratory infections and diseases.

Applications of Recombinant Human SFTPB Protein

The recombinant form of SFTPB protein has shown promising potential in various applications, particularly in the treatment of respiratory diseases. One of the main applications is in the treatment of respiratory distress syndrome (RDS) in premature infants. RDS is caused by a deficiency of surfactant in the lungs, and the administration of recombinant SFTPB protein has been shown to improve lung function and reduce mortality in these infants.

Furthermore, recombinant SFTPB protein has also been studied for its potential use in the treatment of other respiratory diseases such as chronic obstructive pulmonary disease (COPD), cystic fibrosis, and acute respiratory distress syndrome (ARDS). It has been shown to have anti-inflammatory and immunomodulatory effects, making it a potential therapeutic option for these diseases.

Aside from its therapeutic applications, recombinant SFTPB protein is also used in research and diagnostic studies. It can be used as an antigen in immunoassays to detect the presence of anti-SFTPB antibodies in various diseases. Additionally, its structure and function have been extensively studied to gain a better understanding of its role in lung physiology and potential therapeutic interventions.

Conclusion

In conclusion, Recombinant Human SFTPB Protein is a crucial component of the pulmonary surfactant complex and is essential for proper lung function. Its recombinant form has a similar structure and activity to the native form and has shown promising potential in various applications, particularly in the treatment of respiratory diseases. Further research and studies on this protein are needed to fully understand its role and potential therapeutic applications in respiratory diseases.

Recombinant Human SFTPB Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SFTPB Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products