Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AASDHPPT, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRN7
Molecular weight:
38.09 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Ser309
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AASDHPPT, N-His

Product name ARO-P12931-100
Uniprot ID Q9NRN7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Molecular weight 38.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser309
Aliases /Synonyms L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS5 ortholog, AASD-PPT, AASDHPPT, 4'-phosphopantetheinyl transferase
Reference ARO-P12931
Note For research use only.
Molecular Constructor
Met1–Ser309
Product name ARO-P12931-1MG
Uniprot ID Q9NRN7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Molecular weight 38.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser309
Aliases /Synonyms L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS5 ortholog, AASD-PPT, AASDHPPT, 4'-phosphopantetheinyl transferase
Reference ARO-P12931
Note For research use only.
Molecular Constructor
Met1–Ser309
Product name ARO-P12931-50
Uniprot ID Q9NRN7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Molecular weight 38.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser309
Aliases /Synonyms L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS5 ortholog, AASD-PPT, AASDHPPT, 4'-phosphopantetheinyl transferase
Reference ARO-P12931
Note For research use only.
Molecular Constructor
Met1–Ser309

Title: Introduction to Recombinant Human AASDHPPT

Recombinant Human AASDHPPT, also known as Alanyl-tRNA synthetase domain-containing protein 2 (AASDHPPT), is a recombinant protein that plays a crucial role in protein synthesis. This protein is involved in the process of attaching alanine to transfer RNA (tRNA) molecules, which is essential for the production of functional proteins in the body. In this article, we will explore the structure, activity, and applications of Recombinant Human AASDHPPT.

Title: Structure of Recombinant Human AASDHPPT

Recombinant Human AASDHPPT is a 106 kDa protein that consists of 947 amino acids. It is composed of multiple domains, including an N-terminal catalytic domain, a middle domain, and a C-terminal anticodon-binding domain. The N-terminal domain is responsible for the catalytic activity of the protein, while the middle domain plays a role in tRNA recognition. The C-terminal domain binds to the anticodon loop of tRNA, ensuring the accurate attachment of alanine to the tRNA molecule.

Title: Activity of Recombinant Human AASDHPPT

The primary function of Recombinant Human AASDHPPT is to attach alanine to tRNA molecules, which is a critical step in protein synthesis. This process, also known as aminoacylation, is essential for the production of functional proteins in the body. AASDHPPT specifically attaches alanine to tRNA molecules with the anticodon sequence GCU, which is the specific sequence required for alanine incorporation into proteins.

Title: Applications of Recombinant Human AASDHPPT

1. Antibody Production: Recombinant Human AASDHPPT is widely used in antibody production as an antigen for immunization. Antibodies produced against AASDHPPT can be used for various research and diagnostic purposes, such as detecting the presence of AASDHPPT in different tissues or studying its role in various diseases.

2. Drug Development: AASDHPPT has been identified as a potential target for drug development due to its crucial role in protein synthesis. Inhibitors of AASDHPPT could potentially be used to treat diseases caused by abnormal protein synthesis, such as cancer and neurodegenerative disorders.

3. Gene Therapy: Recombinant Human AASDHPPT can also be used in gene therapy to treat genetic disorders caused by mutations in the AASDHPPT gene. By introducing a functional copy of the gene, the production of functional AASDHPPT can be restored, leading to the correction of the underlying genetic defect.

4. Protein Production: AASDHPPT is also used in the production of recombinant proteins. By attaching alanine to tRNA molecules, AASDHPPT ensures the accurate incorporation of alanine into the growing protein chain, resulting in the production of functional proteins.

Title: Conclusion

In conclusion, Recombinant Human AASDHPPT is a crucial protein involved in protein synthesis. Its structure and activity allow for the accurate attachment of alanine to tRNA molecules, which is essential for the production of functional proteins. AASDHPPT has various applications in research, drug development, gene therapy, and protein production, making it a valuable tool in the scientific community. Further research on AASDHPPT could lead to a better understanding of its role in health and disease, potentially leading to the development of new therapeutic strategies.

Recombinant Human AASDHPPT, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AASDHPPT, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products