Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DICER1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPY3
Molecular weight:
34.42 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Leu6–Ser290
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DICER1, N-His

Product name ARO-P13000-100
Uniprot ID Q9UPY3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHS
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu6-Ser290
Aliases /Synonyms DICER, DICER1, Helicase MOI, Endoribonuclease Dicer, Helicase with RNase motif, HERNA, KIAA0928
Reference ARO-P13000
Note For research use only.
Molecular Constructor
Leu6–Ser290
Product name ARO-P13000-1MG
Uniprot ID Q9UPY3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHS
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu6-Ser290
Aliases /Synonyms DICER, DICER1, Helicase MOI, Endoribonuclease Dicer, Helicase with RNase motif, HERNA, KIAA0928
Reference ARO-P13000
Note For research use only.
Molecular Constructor
Leu6–Ser290
Product name ARO-P13000-50
Uniprot ID Q9UPY3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHS
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu6-Ser290
Aliases /Synonyms DICER, DICER1, Helicase MOI, Endoribonuclease Dicer, Helicase with RNase motif, HERNA, KIAA0928
Reference ARO-P13000
Note For research use only.
Molecular Constructor
Leu6–Ser290

Introduction to Recombinant Human DICER1

Recombinant Human DICER1 is a protein that plays a crucial role in the RNA interference (RNAi) pathway, which is a fundamental mechanism for gene regulation in eukaryotic cells. This protein is a key player in the processing of double-stranded RNA (dsRNA) into small interfering RNA (siRNA) molecules, which can then bind to complementary mRNA sequences and silence gene expression. Recombinant Human DICER1 is a valuable tool in the field of molecular biology, as it allows for the production of large quantities of this protein for research and therapeutic purposes.

Structure of Recombinant Human DICER1

The human DICER1 gene encodes a protein of 1922 amino acids, with a predicted molecular weight of approximately 220 kDa. The recombinant form of this protein is typically expressed in mammalian or insect cells, using a variety of expression systems such as baculovirus or plasmid vectors. The resulting protein contains all the functional domains found in the endogenous protein, including the N-terminal DExD/H helicase domain, the PAZ domain, and the C-terminal RNase III domains. These domains are essential for the proper function of DICER1 in the RNAi pathway.

Activity of Recombinant Human DICER1

Recombinant Human DICER1 has the ability to process long dsRNA molecules into siRNAs, which are approximately 21 nucleotides in length. This process involves several steps, including recognition of the dsRNA by the helicase domain, binding of the PAZ domain to the 3’ overhang of the RNA, and cleavage of the dsRNA by the RNase III domains. The resulting siRNA molecules can then be loaded onto the RNA-induced silencing complex (RISC), which guides them to complementary mRNA sequences for gene silencing.

In addition to its role in RNAi, Recombinant Human DICER1 has also been shown to have other functions, such as regulation of gene expression and maintenance of genome stability. It has been implicated in various cellular processes, including development, differentiation, and response to stress. Its dysregulation has been linked to various diseases, including cancer and viral infections.

Applications of Recombinant Human DICER1

The availability of Recombinant Human DICER1 has greatly advanced research in the field of RNAi and gene regulation. This protein is used in various in vitro and in vivo experiments to study the mechanisms of RNAi and its potential therapeutic applications. Recombinant Human DICER1 is also used in the production of siRNAs for gene knockdown experiments, as well as in the development of RNAi-based therapeutics for the treatment of various diseases.

Furthermore, Recombinant Human DICER1 is a valuable tool for the production of monoclonal antibodies. The protein can be used as an antigen to generate specific antibodies against DICER1, which can then be used for various applications, such as immunohistochemistry and western blotting.

Conclusion

In summary, Recombinant Human DICER1 is a crucial protein in the RNAi pathway, with important roles in gene regulation, development, and disease. Its availability in recombinant form has greatly advanced research in this field and has opened up new possibilities for therapeutic interventions. With its various applications in molecular biology, Recombinant Human DICER1 continues to be a valuable tool for scientists studying the intricate mechanisms of gene regulation.

Recombinant Human DICER1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DICER1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products