Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Uniprot ID:
P33426
Molecular weight:
17.77 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Ser459–Pro603
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His

Product name ARO-P12638-100
Uniprot ID P33426
Origin species Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAP
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser459-Pro603
Aliases /Synonyms Secreted protein ORF2; Protein ORF2; pORF2; ORF2, Hepatitis E virus (HEV)
Reference ARO-P12638
Note For research use only.
Molecular Constructor
Ser459–Pro603
Product name ARO-P12638-1MG
Uniprot ID P33426
Origin species Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAP
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser459-Pro603
Aliases /Synonyms Secreted protein ORF2; Protein ORF2; pORF2; ORF2, Hepatitis E virus (HEV)
Reference ARO-P12638
Note For research use only.
Molecular Constructor
Ser459–Pro603
Product name ARO-P12638-50
Uniprot ID P33426
Origin species Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence SRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAVLAP
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser459-Pro603
Aliases /Synonyms Secreted protein ORF2; Protein ORF2; pORF2; ORF2, Hepatitis E virus (HEV)
Reference ARO-P12638
Note For research use only.
Molecular Constructor
Ser459–Pro603

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene encoding the desired protein is inserted into a suitable host organism, such as bacteria or yeast, to produce large quantities of the protein. One such recombinant protein is the Hepatitis E virus genotype 1/HEV-1 ORF2 protein, which has gained significant attention in the field of virology and vaccine development. In this article, we will discuss the structure, activity, and application of this protein.

Structure of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

The Hepatitis E virus (HEV) is a single-stranded RNA virus that causes acute hepatitis in humans. The HEV genome consists of three open reading frames (ORFs): ORF1, ORF2, and ORF3. ORF2 encodes the viral capsid protein, which is responsible for virus assembly and interaction with host cells. The recombinant HEV-1 ORF2 protein is a truncated version of the full-length ORF2, containing only the highly immunogenic regions of the protein.

The recombinant protein is typically produced in Escherichia coli (E. coli) using a plasmid vector. The resulting protein has a molecular weight of approximately 58 kDa and is composed of 533 amino acids. It has a similar structure to the native HEV-1 ORF2 protein, with a conserved N-terminal and C-terminal region, and a central hypervariable region. The protein also contains a number of glycosylation sites, which are important for its antigenicity.

Activity of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

The main activity of the recombinant HEV-1 ORF2 protein is its ability to induce a strong immune response in the host. This is due to its highly immunogenic nature, as well as its structural similarity to the native protein. The protein is able to stimulate both humoral and cellular immune responses, leading to the production of neutralizing antibodies and the activation of T-cells.

The recombinant protein has also been shown to have high binding affinity to the HEV-specific receptor on host cells, allowing it to effectively block virus entry and replication. This makes it a potential candidate for antiviral therapy in addition to its use as a vaccine.

Application of Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein

The recombinant HEV-1 ORF2 protein has a wide range of applications, primarily in the development of vaccines and diagnostic assays for HEV. As mentioned earlier, the protein has strong immunogenic properties, making it an ideal candidate for vaccine development. Several studies have shown that the recombinant protein can effectively induce protective immunity against HEV infection in animal models.

In addition, the recombinant protein has been used in the development of diagnostic assays for HEV detection. These assays utilize the protein as an antigen to detect the presence of HEV-specific antibodies in patient samples, allowing for early detection and diagnosis of HEV infection.

Furthermore, the recombinant protein has been investigated as a potential therapeutic agent for HEV infection. Studies have shown that the protein can effectively inhibit HEV replication and reduce viral load in infected cells, making it a promising candidate for antiviral therapy.

Conclusion

In summary, the recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 protein is a highly immunogenic protein with a similar structure to the native HEV-1 ORF2 protein. It has the ability to induce strong immune responses and has a wide range of applications, including vaccine development, diagnostic assays, and potential antiviral therapy. Further research and development of this protein could lead to improved prevention and treatment of HEV infection.

Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Hepatitis E virus genotype 1/HEV-1 ORF2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products