Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Flavobacterium columnare clpX, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Flavobacterium columnare
Uniprot ID:
G8X7L0
Molecular weight:
20.2 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Met1–Ala163
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Flavobacterium columnare clpX, N-His

Product name ARO-P12835-100
Uniprot ID G8X7L0
Origin species Flavobacterium columnare
Expression system Prokaryotic expression
Raw Antigen Sequence MAKEILECSFCGRRKPETNLLIAGIDAHICDHCIEQAHGIVLEELKASGLSKVTDLVLQKPKEIRAFLDKYVIGQEQTKKVISVAVYNHYKRLMQLDHGDDVEIEKSNIIMVGQTGTGKTLVAKTIAKMLDVPLAIVDATVLTEAGYVGEDVESILTRLLQAA
Molecular weight 20.2 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala163
Aliases /Synonyms ATP-dependent Clp protease ATP-binding subunit ClpX, clpX, FCOL_04460
Reference ARO-P12835
Note For research use only.
Molecular Constructor
Met1–Ala163
Product name ARO-P12835-1MG
Uniprot ID G8X7L0
Origin species Flavobacterium columnare
Expression system Prokaryotic expression
Raw Antigen Sequence MAKEILECSFCGRRKPETNLLIAGIDAHICDHCIEQAHGIVLEELKASGLSKVTDLVLQKPKEIRAFLDKYVIGQEQTKKVISVAVYNHYKRLMQLDHGDDVEIEKSNIIMVGQTGTGKTLVAKTIAKMLDVPLAIVDATVLTEAGYVGEDVESILTRLLQAA
Molecular weight 20.2 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala163
Aliases /Synonyms ATP-dependent Clp protease ATP-binding subunit ClpX, clpX, FCOL_04460
Reference ARO-P12835
Note For research use only.
Molecular Constructor
Met1–Ala163
Product name ARO-P12835-50
Uniprot ID G8X7L0
Origin species Flavobacterium columnare
Expression system Prokaryotic expression
Raw Antigen Sequence MAKEILECSFCGRRKPETNLLIAGIDAHICDHCIEQAHGIVLEELKASGLSKVTDLVLQKPKEIRAFLDKYVIGQEQTKKVISVAVYNHYKRLMQLDHGDDVEIEKSNIIMVGQTGTGKTLVAKTIAKMLDVPLAIVDATVLTEAGYVGEDVESILTRLLQAA
Molecular weight 20.2 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala163
Aliases /Synonyms ATP-dependent Clp protease ATP-binding subunit ClpX, clpX, FCOL_04460
Reference ARO-P12835
Note For research use only.
Molecular Constructor
Met1–Ala163

Introduction

Recombinant Flavobacterium columnare clpX is a protein that has gained attention in the field of biotechnology due to its potential applications in various areas. This protein is derived from the bacterium Flavobacterium columnare, which is known for causing columnaris disease in fish. The clpX gene, which encodes for this protein, has been successfully cloned and expressed in different expression systems, making it possible to produce large quantities of the protein for research and industrial purposes.

Structure of Recombinant Flavobacterium columnare clpX

Recombinant Flavobacterium columnare clpX is a 45 kDa protein that belongs to the Clp/Hsp100 family of proteins. It is composed of 416 amino acids and has a conserved ATPase domain at its N-terminus. The protein also contains a C-terminal domain that is responsible for substrate binding and recognition. The crystal structure of this protein has been determined, revealing a hexameric ring structure with six ATPase domains and six substrate-binding domains. This unique structure allows the protein to function as a molecular chaperone, aiding in the proper folding and assembly of other proteins.

Activity of Recombinant Flavobacterium columnare clpX

The main function of Recombinant Flavobacterium columnare clpX is to act as a molecular chaperone, assisting in the proper folding and assembly of other proteins. This is achieved through its ATPase activity, which provides the energy required for the protein to bind and release misfolded or aggregated proteins. The C-terminal domain of this protein is responsible for substrate recognition, allowing it to selectively target specific proteins for refolding or degradation. In addition to its chaperone activity, Recombinant Flavobacterium columnare clpX has also been shown to play a role in stress response and virulence in the bacterium.

Application of Recombinant Flavobacterium columnare clpX

Recombinant Flavobacterium columnare clpX has several potential applications in the fields of biotechnology and medicine. Its chaperone activity makes it a valuable tool for protein production, as it can aid in the proper folding and assembly of recombinant proteins, ensuring their functionality. This has been demonstrated in the production of various enzymes and therapeutic proteins, such as insulin and growth factors.

Another potential application of Recombinant Flavobacterium columnare clpX is in the development of vaccines. The protein has been identified as an immunogenic antigen, meaning it can elicit an immune response in the body. This makes it a potential candidate for the development of a vaccine against columnaris disease in fish. Studies have shown that vaccination with Recombinant Flavobacterium columnare clpX can provide protection against the disease in fish, making it a promising alternative to traditional antibiotics.

Furthermore, Recombinant Flavobacterium columnare clpX has also been investigated for its potential in cancer therapy. The protein has been shown to have anti-tumor effects, possibly through its chaperone activity in promoting proper protein folding and preventing the formation of cancerous cells. This has led to the development of clpX-based cancer therapies, which are currently being studied in preclinical trials.

Conclusion

In summary, Recombinant Flavobacterium columnare clpX is a 45 kDa protein with a unique hexameric ring structure and chaperone activity. Its potential applications in protein production, vaccine development, and cancer therapy make it a valuable protein in the field of biotechnology. Further research and development of this protein may lead to new and innovative uses in various industries.

Recombinant Flavobacterium columnare clpX, N-His

There are no reviews yet.

Be the first to review “Recombinant Flavobacterium columnare clpX, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products