Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Rice Putative receptor protein kinase, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Rice
Uniprot ID:
Q75KZ6
Molecular weight:
31.61 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Asn570–Ile841
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Rice Putative receptor protein kinase, C-His

Product name ARO-P12830-100
Uniprot ID Q75KZ6
Origin species Rice
Expression system Prokaryotic expression
Raw Antigen Sequence NFSDNHEIGSGGYGKVYRGILGDGTRVAIKRADRNSMQGAVEFKNEIELLSRVHHRNLVSLIGFCYEQGEQMLVYEYISNGTLRENLTGSGMYLDWKKRLRIALGSARGLAYLHELADPPIIHRDIKSTNILLDNNLKAKVADFGLSKLVADTEKGHVSTQVKGTLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGRYVVREVRLAIDPADHDHHYGLRGIVDPAIRDAARTPVFRRFVQLAMRCVDESAAARPAMGAVVKEI
Molecular weight 31.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn570-Ile841
Aliases /Synonyms Putative receptor protein kinase, OJ1004_E02.6, Plant
Reference ARO-P12830
Note For research use only.
Molecular Constructor
Asn570–Ile841
Product name ARO-P12830-1MG
Uniprot ID Q75KZ6
Origin species Rice
Expression system Prokaryotic expression
Raw Antigen Sequence NFSDNHEIGSGGYGKVYRGILGDGTRVAIKRADRNSMQGAVEFKNEIELLSRVHHRNLVSLIGFCYEQGEQMLVYEYISNGTLRENLTGSGMYLDWKKRLRIALGSARGLAYLHELADPPIIHRDIKSTNILLDNNLKAKVADFGLSKLVADTEKGHVSTQVKGTLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGRYVVREVRLAIDPADHDHHYGLRGIVDPAIRDAARTPVFRRFVQLAMRCVDESAAARPAMGAVVKEI
Molecular weight 31.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn570-Ile841
Aliases /Synonyms Putative receptor protein kinase, OJ1004_E02.6, Plant
Reference ARO-P12830
Note For research use only.
Molecular Constructor
Asn570–Ile841
Product name ARO-P12830-50
Uniprot ID Q75KZ6
Origin species Rice
Expression system Prokaryotic expression
Raw Antigen Sequence NFSDNHEIGSGGYGKVYRGILGDGTRVAIKRADRNSMQGAVEFKNEIELLSRVHHRNLVSLIGFCYEQGEQMLVYEYISNGTLRENLTGSGMYLDWKKRLRIALGSARGLAYLHELADPPIIHRDIKSTNILLDNNLKAKVADFGLSKLVADTEKGHVSTQVKGTLGYLDPEYYMTQQLSEKSDVYSFGVVMLELVSGRQPIEKGRYVVREVRLAIDPADHDHHYGLRGIVDPAIRDAARTPVFRRFVQLAMRCVDESAAARPAMGAVVKEI
Molecular weight 31.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn570-Ile841
Aliases /Synonyms Putative receptor protein kinase, OJ1004_E02.6, Plant
Reference ARO-P12830
Note For research use only.
Molecular Constructor
Asn570–Ile841

Title: Introduction to Recombinant Rice Putative Receptor Protein Kinase

Recombinant Rice Putative Receptor Protein Kinase (RRPRPK) is a type of protein kinase that is derived from rice plants through recombinant DNA technology. This protein has gained significant attention in the field of biotechnology due to its potential applications in agriculture and medicine. In this article, we will delve into the structure, activity, and applications of RRPRPK.

Structure of RRPRPK

RRPRPK is a transmembrane protein that is composed of 1,087 amino acids. The protein consists of three main domains: the extracellular domain, the transmembrane domain, and the intracellular domain. The extracellular domain is responsible for binding to specific ligands, while the intracellular domain contains the catalytic site for protein kinase activity.

Activity of RRPRPK

RRPRPK belongs to the receptor-like protein kinase (RLK) family, which plays a crucial role in various signaling pathways in plants. The protein kinase activity of RRPRPK is activated upon binding to specific ligands, such as hormones or pathogen-derived molecules. This activation triggers a cascade of events that leads to the phosphorylation of downstream proteins, ultimately resulting in a cellular response.

One of the key functions of RRPRPK is its role in plant defense against pathogens. Upon recognition of pathogen-derived molecules, RRPRPK activates a defense response by phosphorylating downstream proteins involved in plant immunity. This makes RRPRPK an important component in developing disease-resistant crops.

In addition to its role in plant defense, RRPRPK also plays a crucial role in plant growth and development. Studies have shown that RRPRPK is involved in regulating various processes such as seed germination, root growth, and flowering. This highlights the potential of RRPRPK in improving crop yield and quality.

Applications of RRPRPK

The unique structure and activity of RRPRPK make it a promising candidate for various applications in agriculture and medicine.

In agriculture, RRPRPK has the potential to be used in the development of genetically modified (GM) crops with enhanced disease resistance. By introducing the gene for RRPRPK into crop plants, they can be equipped with a more effective defense mechanism against pathogens, reducing the need for chemical pesticides. This can lead to a more sustainable and environmentally friendly approach to crop protection.

Moreover, RRPRPK can also be utilized in plant breeding to introduce desirable traits, such as increased yield or stress tolerance, into crop plants. This can be achieved through genetic engineering techniques, where the gene for RRPRPK is inserted into the genome of the target plant.

In the field of medicine, RRPRPK has potential applications in the development of vaccines and therapeutics. The extracellular domain of RRPRPK can be used as an antigen to induce an immune response against specific diseases. This has been demonstrated in a study where the extracellular domain of RRPRPK was used as a vaccine against a viral pathogen in mice.

Furthermore, the protein kinase activity of RRPRPK can also be targeted for the development of therapeutic drugs. As RRPRPK is involved in various signaling pathways, it can be a potential target for the treatment of diseases such as cancer, where abnormal signaling is a hallmark.

Conclusion

In conclusion, Recombinant Rice Putative Receptor Protein Kinase is a promising protein with diverse applications in agriculture and medicine. Its unique structure and activity make it an important component in plant defense and growth, as well as a potential candidate for the development of vaccines and therapeutics. Further research and development in this field can lead to the utilization of RRPRPK for the benefit of society.

Recombinant Rice Putative receptor protein kinase, C-His

There are no reviews yet.

Be the first to review “Recombinant Rice Putative receptor protein kinase, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products