Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Clostridioides difficile
Uniprot ID:
P16154
Molecular weight:
16.53 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Tyr2583–Gly2710
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His
Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His

Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His

Product name ARO-P12727-100
Uniprot ID P16154
Origin species Clostridioides difficile
Expression system Prokaryotic expression
Raw Antigen Sequence YYFEPNTAMGANGYKTIDNKNFYFRNGLPQIGVFKGSNGFEYFAPANTDANNIEGQAIRYQNRFLHLLGKIYYFGNNSKAVTGWQTINGKVYYFMPDTAMAAAGGLFEIDGVIYFFGVDGVKAPGIYG
Molecular weight 16.53 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr2583-Gly2710
Aliases /Synonyms Toxin A, 3.4.22.-, Glucosyltransferase TcdA, 2.4.1.-, tcdA, toxA,Clostridium difficile Toxin
Reference ARO-P12727
Note For research use only.
Molecular Constructor
Tyr2583–Gly2710
Product name ARO-P12727-1MG
Uniprot ID P16154
Origin species Clostridioides difficile
Expression system Prokaryotic expression
Raw Antigen Sequence YYFEPNTAMGANGYKTIDNKNFYFRNGLPQIGVFKGSNGFEYFAPANTDANNIEGQAIRYQNRFLHLLGKIYYFGNNSKAVTGWQTINGKVYYFMPDTAMAAAGGLFEIDGVIYFFGVDGVKAPGIYG
Molecular weight 16.53 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr2583-Gly2710
Aliases /Synonyms Toxin A, 3.4.22.-, Glucosyltransferase TcdA, 2.4.1.-, tcdA, toxA,Clostridium difficile Toxin
Reference ARO-P12727
Note For research use only.
Molecular Constructor
Tyr2583–Gly2710
Product name ARO-P12727-50
Uniprot ID P16154
Origin species Clostridioides difficile
Expression system Prokaryotic expression
Raw Antigen Sequence YYFEPNTAMGANGYKTIDNKNFYFRNGLPQIGVFKGSNGFEYFAPANTDANNIEGQAIRYQNRFLHLLGKIYYFGNNSKAVTGWQTINGKVYYFMPDTAMAAAGGLFEIDGVIYFFGVDGVKAPGIYG
Molecular weight 16.53 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr2583-Gly2710
Aliases /Synonyms Toxin A, 3.4.22.-, Glucosyltransferase TcdA, 2.4.1.-, tcdA, toxA,Clostridium difficile Toxin
Reference ARO-P12727
Note For research use only.
Molecular Constructor
Tyr2583–Gly2710

SDS-PAGE for Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His

SDS-PAGE for Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His

Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Clostridioides difficile Toxin A/tcdA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products