Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Protein A, von Willebrand factor binding protein Spa(spa)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A098GZT2 or P38507
Molecular weight:
38.33kDa

Original price was: €273.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
Met1~Lys327
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Protein A, von Willebrand factor binding protein Spa(spa)

Product name Protein A, von Willebrand factor binding protein Spa(spa)
Uniprot ID A0A098GZT2 or P38507
Uniprot link http://www.uniprot.org/uniprot/A0A098GZT2
Expression system Prokaryotic expression
Raw Antigen Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 38.33kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A
Reference PX-P4556
Note For research use only
Molecular Constructor
Met1~Lys327
Product name Protein A, von Willebrand factor binding protein Spa(spa)
Uniprot ID A0A098GZT2 or P38507
Uniprot link http://www.uniprot.org/uniprot/A0A098GZT2
Expression system Prokaryotic expression
Raw Antigen Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 38.33kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A
Reference PX-P4556
Note For research use only
Molecular Constructor
Met1~Lys327
Product name PX-P4556-1MG
Uniprot ID A0A098GZT2 or P38507
Uniprot link http://www.uniprot.org/uniprot/A0A098GZT2
Expression system Prokaryotic expression
Raw Antigen Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 38.33kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A
Reference PX-P4556
Note For research use only
Molecular Constructor
Met1~Lys327

Protein A, von Willebrand factor binding protein Spa(spa)

There are no reviews yet.

Be the first to review “Protein A, von Willebrand factor binding protein Spa(spa)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products