Name: Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
SKU: PX-P4721-10
Availability: InStock

Product name	Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID	P50416
Uniprot link	https://www.uniprot.org/uniprot/P50416
Expression system	Prokaryotic expression
Sequence	QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight	38.45 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Gln406-Thr745
Protein Accession	P50416
Spec:Entrez GeneID	1374
Spec:NCBI Gene Aliases	CPT1; CPT1-L; L-CPT1
Spec:SwissProtID	Q8TCU0
NCBI Reference	P50416
Aliases /Synonyms	CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference	PX-P4721
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-P4721 210€

View product