Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Placenta-specific protein 1(PLAC1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9HBJ0
Molecular weight:
48.75kDa

Original price was: €231.00.Current price is: €182.00.

50ug 21% OFF + 182 loyalty points
Gln23–Met212
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Placenta-specific protein 1(PLAC1)

Product name Placenta-specific protein 1(PLAC1)
Uniprot ID Q9HBJ0
Uniprot link https://www.uniprot.org/uniprot/Q9HBJ0
Expression system Prokaryotic expression
Raw Antigen Sequence GSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGS
Molecular weight 48.75kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln23-Met212
Reference PX-P4344
Note For research use only
Molecular Constructor
Gln23–Met212
Product name Placenta-specific protein 1(PLAC1)
Uniprot ID Q9HBJ0
Uniprot link https://www.uniprot.org/uniprot/Q9HBJ0
Expression system Prokaryotic expression
Raw Antigen Sequence GSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGS
Molecular weight 48.75kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln23-Met212
Reference PX-P4344
Note For research use only
Molecular Constructor
Gln23–Met212
Product name PX-P4344-1MG
Uniprot ID Q9HBJ0
Uniprot link https://www.uniprot.org/uniprot/Q9HBJ0
Expression system Prokaryotic expression
Raw Antigen Sequence GSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGS
Molecular weight 48.75kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln23-Met212
Reference PX-P4344
Note For research use only
Molecular Constructor
Gln23–Met212

General information on Placenta-specific protein 1(PLAC1):

Placenta-specific protein 1 is a small secreted cell surface protein (212 amino acids) encoded by the PLAC1 gene on the X chromosome. Since its discovery in 1999, PLAC1 has played a role in the development and maintenance of the placenta, including preeclampsia, fetal development, and many cancers.

Placenta-specific protein 1(PLAC1)

There are no reviews yet.

Be the first to review “Placenta-specific protein 1(PLAC1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products