Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mite allergen Blo t 5(BLOT5)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O96870
Molecular weight:
16.22KDa

Original price was: €222.00.Current price is: €182.00.

50ug 18% OFF + 182 loyalty points
Gln18–Gln134
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mite allergen Blo t 5(BLOT5)

Product name Mite allergen Blo t 5(BLOT5)
Uniprot ID O96870
Uniprot link https://www.uniprot.org/uniprot/O96870
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight 16.22KDa
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Gln134
Aliases /Synonyms BLOT5/Mite allergen Blo t
Reference PX-P4389
Note For research use only
Molecular Constructor
Gln18–Gln134
Product name Mite allergen Blo t 5(BLOT5)
Uniprot ID O96870
Uniprot link https://www.uniprot.org/uniprot/O96870
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight 16.22KDa
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Gln134
Aliases /Synonyms BLOT5/Mite allergen Blo t
Reference PX-P4389
Note For research use only
Molecular Constructor
Gln18–Gln134
Product name PX-P4389-1MG
Uniprot ID O96870
Uniprot link https://www.uniprot.org/uniprot/O96870
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight 16.22KDa
Purity estimated 90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Gln134
Aliases /Synonyms BLOT5/Mite allergen Blo t
Reference PX-P4389
Note For research use only
Molecular Constructor
Gln18–Gln134

Mite allergen Blo t 5(BLOT5)

There are no reviews yet.

Be the first to review “Mite allergen Blo t 5(BLOT5)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products