Name: Human Golgi membrane protein 1 (GP73) recombinant protein
SKU: PX-P4051-10
Availability: InStock

Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Signal Transduction

Product name	Human Golgi membrane protein 1 (GP73) recombinant protein
Uniprot ID	Q8NBJ4
Uniprot link	http://www.uniprot.org/uniprot/Q8NBJ4
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Molecular weight	42.35kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	50 mM Tris-HCl pH 8, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Aliases /Synonyms	GOLM1, GOLPH2, C9orf155, Golgi Membrane Protein 1, Golgi Phosphoprotein 2, GP73
Reference	PX-P4051
Note	For research use only

Description of Human Golgi membrane protein 1 (GP73) recombinant protein

General Information about Human Golgi membrane protein 1 (GP73) recombinant protein

Golgi complex plays a key role in the ordering and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is the Golgi type II transmembrane protein. It processes the proteins synthesized in the rough endoplasmic reticulum and aids in the transport of the protein load through the Golgi apparatus. It has been observed that the expression of this gene is regulated by viral infection. Alternatively, an explicit transcription code encoding the same protein has been described for this gene.

Datasheet Download

MSDS Download

Reviews

There are no reviews yet.