Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P0A0Z8
Molecular weight:
26.86kDa

Original price was: €237.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
Met1–Ser228
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag

Product name N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag
Uniprot ID P0A0Z8
Uniprot link https://www.uniprot.org/uniprot/P0A0Z8
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.86kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.5+10%Glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms siaB, synB, CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase
Reference PX-P4319
Note For research use only
Molecular Constructor
Met1–Ser228
Product name N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag
Uniprot ID P0A0Z8
Uniprot link https://www.uniprot.org/uniprot/P0A0Z8
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.86kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.5+10%Glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms siaB, synB, CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase
Reference PX-P4319
Note For research use only
Molecular Constructor
Met1–Ser228
Product name PX-P4319-1MG
Uniprot ID P0A0Z8
Uniprot link https://www.uniprot.org/uniprot/P0A0Z8
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.86kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.5+10%Glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms siaB, synB, CMP-N-acetylneuraminic acid synthase,CMP-NeuNAc synthase,CMP-sialic acid synthase
Reference PX-P4319
Note For research use only
Molecular Constructor
Met1–Ser228

N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag

There are no reviews yet.

Be the first to review “N-acylneuraminate cytidylyltransferase(neuA) His Strep Tag”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products