Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Leishmania tropica TSA Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Leishmania tropica
Uniprot ID:
Q07DU5
Molecular weight:
23,47 kDa

Original price was: €250.00.Current price is: €210.00.

50ug 16% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Leishmania tropica TSA Recombinant Protein

Product name Leishmania tropica TSA Recombinant Protein
Uniprot ID Q07DU5
Uniprot link http://www.uniprot.org/uniprot/Q07DU5
Origin species Leishmania tropica
Expression system Prokaryotic expression
Raw Antigen Sequence MSCGETKINSPAPPFEEMALMPNGSFKKISLSAYKGKWVVLFFYPLDFTFVCPTEIIAFSDNVSRFNELNCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMVRQITVNDMPVGRNVEEVLRLLEALQFVEKHGEVCPANWKKGAPTMKPEPKASVEGYFSKQ
Molecular weight 23,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Spec:SwissProtID Q07DU5
NCBI Reference AAZ23601.1
Aliases /Synonyms TSA, Peroxidoxin 2 / Thiol-specific Antioxidant Antigen (TSA)
Reference PX-P1165
Note For research use only
Molecular Constructor
Full-length Yes
Product name Leishmania tropica TSA Recombinant Protein
Uniprot ID Q07DU5
Uniprot link http://www.uniprot.org/uniprot/Q07DU5
Origin species Leishmania tropica
Expression system Prokaryotic expression
Raw Antigen Sequence MSCGETKINSPAPPFEEMALMPNGSFKKISLSAYKGKWVVLFFYPLDFTFVCPTEIIAFSDNVSRFNELNCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMVRQITVNDMPVGRNVEEVLRLLEALQFVEKHGEVCPANWKKGAPTMKPEPKASVEGYFSKQ
Molecular weight 23,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Spec:SwissProtID Q07DU5
NCBI Reference AAZ23601.1
Aliases /Synonyms TSA, Peroxidoxin 2 / Thiol-specific Antioxidant Antigen (TSA)
Reference PX-P1165
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1165-1MG
Uniprot ID Q07DU5
Uniprot link http://www.uniprot.org/uniprot/Q07DU5
Origin species Leishmania tropica
Expression system Prokaryotic expression
Raw Antigen Sequence MSCGETKINSPAPPFEEMALMPNGSFKKISLSAYKGKWVVLFFYPLDFTFVCPTEIIAFSDNVSRFNELNCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMVRQITVNDMPVGRNVEEVLRLLEALQFVEKHGEVCPANWKKGAPTMKPEPKASVEGYFSKQ
Molecular weight 23,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Spec:SwissProtID Q07DU5
NCBI Reference AAZ23601.1
Aliases /Synonyms TSA, Peroxidoxin 2 / Thiol-specific Antioxidant Antigen (TSA)
Reference PX-P1165
Note For research use only
Molecular Constructor
Full-length Yes

Leishmania tropica TSA Recombinant Protein

There are no reviews yet.

Be the first to review “Leishmania tropica TSA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products