S. pombe Smc1Nter Recombinant Protein

Reference:
Product nameS. pombe Smc1Nter Recombinant Protein
Uniprot IDO94383
Uniprot linkhttp://www.uniprot.org/uniprot/O94383
Origin speciesS. pombe
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLPRAMGRLLRLEVENFKSYRGHQIIGPFEDFTSIIGPNGAGKSNLMDAISFVLGVKSSHLRSTNVKELIY RGKILQRDNTDFTDSSNPTTAYVKLMYELDNGEQREYKRAITPSGATEYKIDEEIVTFSEYCGSLQKENILVRARNFLVF QGDVETIASQSPLELSKLVEQISGSLEYKSEYDKSKDEQDKAVNLSAHSFNKKRGINAELRQYQEQKTEAERYQSQKEKR DSAQLVYLLWKLFHLEKSISSNMAEVTRLKADSIQLIERRDENTKEIEKLKEKEGSIRRNLLAFDRKVRKQEKLIASKRP ELISIAEKALESKSNLRKIQRKAAEIEKDYSDQASTLQVLENQLTSLSAAEKEFLKDMQEKEQLKGLRLLPEDKEEYEGL RSEADKLNSNLLFKLQTLNRNIKVTSQSKDSLTSIVGDLESKIKSLHESVSSLDTERADLLAKINEKIESLELEKHDQQK KRLTYSELFHKTQELNEELQSCLQKILEASADRNESKQDAKKREALYALKRIYPEVKGRIIDLCTPTQKKYESAIAAALG KNFDAIVVETQAVAKECIDYIKEQRIGIMTFFPMDTIAASPVNQKFRGTHKGARLAIDVLNFESEYERVMISAVGNTLIC DSMTV
Molecular weight73,78 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferNaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionO94383.2 (Unip
Spec:Entrez GeneID2540557
Spec:NCBI Gene Aliasessmc1
Spec:SwissProtIDO94383
NCBI ReferenceO94383.2 (Uniprot)*
Aliases /SynonymsSmc1Nter, Structural maintenance of chromosomes protein 1
ReferencePX-P1152
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “S. pombe Smc1Nter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.