Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pasotuxizumab Biosimilar – Anti-CD3E, FOLH1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
(scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade

Product name Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS 1442657-12-6
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pasotuxizumab,BAY 2010112,BITE MT112,MT-112,CD3E, FOLH1,anti-CD3E, FOLH1
Reference PX-TA1353
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag
Clonality Monoclonal Antibody
Product name Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS 1442657-12-6
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pasotuxizumab,BAY 2010112,BITE MT112,MT-112,CD3E, FOLH1,anti-CD3E, FOLH1
Reference PX-TA1353
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag
Clonality Monoclonal Antibody
Product name PX-TA1353-50
Uniprot ID Q04609 & P07766
Source CAS 1442657-12-6
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pasotuxizumab,BAY 2010112,BITE MT112,MT-112,CD3E, FOLH1,anti-CD3E, FOLH1
Reference PX-TA1353
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag
Clonality Monoclonal Antibody

Introduction

Pasotuxizumab Biosimilar, also known as Anti-CD3E, FOLH1 mAb, is a monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody, Pasotuxizumab, which targets the CD3E and FOLH1 proteins. This biosimilar is a promising candidate for the treatment of various diseases, and its structure, activity, and potential applications will be discussed in this article.

Structure of Pasotuxizumab Biosimilar

Pasotuxizumab Biosimilar is a fully human monoclonal antibody that is composed of two heavy chains and two light chains. It has a molecular weight of approximately 150 kDa and is produced using recombinant DNA technology. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab region is responsible for binding to the target proteins, CD3E and FOLH1, while the Fc region is involved in immune effector functions.

Activity of Pasotuxizumab Biosimilar

Pasotuxizumab Biosimilar binds specifically to the CD3E and FOLH1 proteins, which are expressed on the surface of immune cells and cancer cells, respectively. This binding leads to the activation of immune cells, such as T cells, and the inhibition of cancer cell growth. Pasotuxizumab Biosimilar has been shown to induce apoptosis (programmed cell death) in cancer cells, as well as activate immune cells to attack and destroy cancer cells.

In addition to its anti-

cancer activity, Pasotuxizumab Biosimilar has also been found to have immunomodulatory effects. It can regulate the immune response by promoting the production of anti-inflammatory cytokines and inhibiting the production of pro-inflammatory cytokines. This makes it a potential treatment option for autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis.

Application of Pasotuxizumab Biosimilar

Pasotuxizumab Biosimilar is currently being investigated as a potential treatment for various types of cancer, including prostate cancer, ovarian cancer, and colorectal cancer. It has shown promising results in preclinical studies and is now being evaluated in clinical trials. The biosimilar is being tested as a monotherapy and in combination with other anti- cancer drugs, and early results have shown good efficacy and safety profiles.

Apart from its potential in cancer treatment, Pasotuxizumab Biosimilar also has potential applications in the treatment of autoimmune diseases. Its immunomodulatory effects make it a promising candidate for the treatment of diseases where the immune system is overactive, such as rheumatoid arthritis and multiple sclerosis. Clinical trials for these indications are also underway.

Conclusion

In conclusion, Pasotuxizumab Biosimilar is a fully human monoclonal antibody that targets the CD3E and FOLH1 proteins. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases, especially cancer and autoimmune diseases. Further research and clinical trials are needed to fully understand the potential of this biosimilar and its role in improving patient outcomes.

Pasotuxizumab Biosimilar - Anti-FOLH1;PSMA and CD3E mAb - Research Grade in ELISA Assay

Pasotuxizumab Biosimilar - Anti-FOLH1;PSMA and CD3E mAb - Research Grade in ELISA Assay

Pasotuxizumab Biosimilar - Anti-FOLH1;PSMA and CD3E mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade

  • Vele — April 6, 2022

    Great product!

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products