Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Inbakicept Biosimilar – Anti-IL15 fusion protein – Research Grade

Uniprot ID:
P40933

Original price was: €256.00.Current price is: €210.00.

50ug 18% OFF + 210 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade

Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2015-50
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)

Inbakicept Biosimilar: A Promising Anti-IL15 Fusion Protein for Therapeutic Targeting

Inbakicept Biosimilar is a novel, research-grade fusion protein that has shown promising potential as a therapeutic agent for various inflammatory and autoimmune diseases. This fusion protein is a biosimilar of Inbakicept, a recombinant protein that is currently in clinical development for the treatment of lupus nephritis and rheumatoid arthritis. Inbakicept Biosimilar is designed to specifically target and neutralize interleukin-15 (IL15), a cytokine that plays a crucial role in the pathogenesis of many autoimmune disorders.

Structure of Inbakicept Biosimilar

Inbakicept Biosimilar is a fusion protein composed of two components: the extracellular domain of the human IL15 receptor alpha chain (IL15Rα) and the Fc region of human IgG1. The IL15Rα domain is responsible for binding to IL15, while the Fc region provides stability and prolongs the half-life of the fusion protein in circulation. This structure allows Inbakicept Biosimilar to act as a competitive antagonist of IL15, preventing its interaction with the IL15 receptor complex and subsequent signaling pathways.

Activity of Inbakicept Biosimilar

The primary activity of Inbakicept Biosimilar is to inhibit the pro-inflammatory effects of IL15. IL15 is a cytokine that is produced by various immune cells, including T cells, B cells, and macrophages. It plays a critical role in the activation and proliferation of immune cells, as well as the production of pro-inflammatory cytokines. In autoimmune diseases, IL15 is overexpressed and contributes to the chronic inflammation and tissue damage seen in these conditions. By binding to IL15 and preventing its interaction with the IL15 receptor complex, Inbakicept Biosimilar effectively blocks the downstream inflammatory signaling pathways, reducing inflammation and tissue damage.

Moreover, Inbakicept Biosimilar has been shown to have immunomodulatory effects, including the induction of regulatory T cells and suppression of pro-inflammatory cytokine production. These additional activities further contribute to the anti-inflammatory effects of Inbakicept Biosimilar, making it a promising therapeutic agent for various autoimmune diseases.

Application of Inbakicept Biosimilar

Inbakicept Biosimilar has shown potential for the treatment of several autoimmune and inflammatory diseases, including rheumatoid arthritis, systemic lupus erythematosus, psoriasis, and inflammatory bowel disease. In preclinical studies, Inbakicept Biosimilar has demonstrated efficacy in reducing disease severity and improving clinical symptoms in animal models of these diseases.

Currently, Inbakicept Biosimilar is in the early stages of clinical development for the treatment of lupus nephritis and rheumatoid arthritis. In a phase II clinical trial for lupus nephritis, Inbakicept showed promising results in reducing disease activity and improving kidney function. In a phase I study for rheumatoid arthritis, Inbakicept was well-tolerated and showed a favorable safety profile.

Additionally, Inbakicept Biosimilar has the potential to be used in combination with other therapies, such as disease-modifying anti-rheumatic drugs (DMARDs) and biologic agents, to enhance their efficacy and reduce the risk of adverse effects.

Conclusion

Inbakicept Biosimilar is a promising anti-IL15 fusion protein that has shown potential as a therapeutic agent for various autoimmune and inflammatory diseases. Its unique structure and mechanism of action make it a promising alternative to current treatments for these conditions. With ongoing clinical development and further research, Inbakicept Biosimilar has the potential to improve the lives of patients suffering from these debilitating diseases.

Keywords: Inbakicept Biosimilar, anti-IL15 fusion protein, therapeutic target, autoimmune diseases, inflammatory diseases, cytokine, IL15 receptor, biosimilar, immunomod

SDS-PAGE for Research Grade Inbakicept

SDS-PAGE for Research Grade Inbakicept

Research Grade Inbakicept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Inbakicept Biosimilar – Anti-IL15 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products