Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Obrindatamab Biosimilar – Anti-CD276;CD3E mAb – Research Grade

  • PX-TA1692-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Bispecific scFv with Domain Crossover,Kappa;Lambda

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Obrindatamab Biosimilar - Anti-CD276;CD3E mAb - Research Grade

Product name Obrindatamab Biosimilar - Anti-CD276;CD3E mAb - Research Grade
Uniprot ID Q5ZPR3 & P07766
Source CAS 2069959-72-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Obrindatamab,DUAL-AFFINITY B7-H3/CD3-TARGETED PROTEIN MGD009, MGD-009,CD276;CD3E,anti-CD276;CD3E
Reference PX-TA1692
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific scFv with Domain Crossover,Kappa;Lambda
Clonality Monoclonal Antibody
Product name Obrindatamab Biosimilar - Anti-CD276;CD3E mAb - Research Grade
Uniprot ID Q5ZPR3 & P07766
Source CAS 2069959-72-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Obrindatamab,DUAL-AFFINITY B7-H3/CD3-TARGETED PROTEIN MGD009, MGD-009,CD276;CD3E,anti-CD276;CD3E
Reference PX-TA1692
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific scFv with Domain Crossover,Kappa;Lambda
Clonality Monoclonal Antibody
Product name PX-TA1692-50
Uniprot ID Q5ZPR3 & P07766
Source CAS 2069959-72-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Obrindatamab,DUAL-AFFINITY B7-H3/CD3-TARGETED PROTEIN MGD009, MGD-009,CD276;CD3E,anti-CD276;CD3E
Reference PX-TA1692
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific scFv with Domain Crossover,Kappa;Lambda
Clonality Monoclonal Antibody

Obrindatamab Biosimilar: A Novel Anti-CD276,CD3E mAb for Therapeutic Targeting

Obrindatamab Biosimilar is a novel monoclonal antibody (mAb) that has been developed as a biosimilar version of the therapeutic antibody, Obrintuzumab. This biosimilar has been designed to specifically target the cell surface proteins CD276 and CD3E, which are known to play important roles in cancer progression and immune response. In this article, we will discuss the structure, activity, and potential applications of Obrindatamab Biosimilar as a therapeutic agent.

Structure of Obrindatamab Biosimilar

Obrindatamab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, which means it is derived from human antibody sequences but has been modified to reduce its immunogenicity. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains, which are linked together by disulfide bonds. The variable regions of the antibody are responsible for binding to the target proteins, CD276 and CD3E, while the constant regions mediate effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Obrindatamab Biosimilar

Obrindatamab Biosimilar exerts its activity by binding to CD276 and CD3E on the surface of cancer cells. CD276, also known as B7-H3, is a cell surface protein that is overexpressed in various types of cancer, including breast, lung, and prostate cancer. It has been shown to promote tumor growth, invasion, and metastasis, as well as suppress immune responses. CD3E, on the other hand, is a component of the T-cell receptor complex that is essential for T-cell activation and function. By targeting both CD276 and CD3E, Obrindatamab Biosimilar can simultaneously inhibit tumor growth and enhance immune-mediated tumor cell killing.

Obrindatamab Biosimilar has also been shown to have a higher binding affinity for CD276 compared to Obrintuzumab, which may result in improved efficacy and potency. Furthermore, it has been engineered to have a longer half-life, which allows for less frequent dosing and potentially better patient compliance.

Applications of Obrindatamab Biosimilar

Obrindatamab Biosimilar is being investigated as a potential treatment for various types of cancer, including breast, lung, and ovarian cancer. It has shown promising results in preclinical studies, demonstrating potent antitumor activity and improved survival in animal models. In addition, a phase I clinical trial is currently ongoing to evaluate the safety and efficacy of Obrindatamab Biosimilar in patients with relapsed or refractory B-cell non-Hodgkin lymphoma.

Moreover, Obrindatamab Biosimilar has the potential to be used in combination with other cancer therapies, such as chemotherapy and immune checkpoint inhibitors. By targeting both the tumor cells and the immune system, it may enhance the efficacy of these treatments and overcome resistance to therapy.

Conclusion

Obrindatamab Biosimilar is a promising therapeutic agent that specifically targets CD276 and CD3E, two proteins that play critical roles in cancer progression and immune response. Its unique structure and improved binding affinity make it a potential alternative to Obrintuzumab, with the potential for improved efficacy and potency. With ongoing clinical trials and potential applications in various types of cancer, Obrindatamab Biosimilar has the potential to become a valuable addition to the arsenal of cancer treatments.

Obrindatamab Biosimilar - Anti-CD276,CD3E mAb - Research Grade in ELISA Assay

Obrindatamab Biosimilar - Anti-CD276,CD3E mAb - Research Grade in ELISA Assay

Obrindatamab Biosimilar - Anti-CD276,CD3E mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Obrindatamab Biosimilar - Anti-CD276,CD3E mAb - Research Grade

SDS-PAGE for Obrindatamab Biosimilar - Anti-CD276,CD3E mAb - Research Grade

Obrindatamab Biosimilar - Anti-CD276,CD3E mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Obrindatamab Biosimilar - Anti-CD276;CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Obrindatamab Biosimilar – Anti-CD276;CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products