Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Obertamig Biosimilar – Anti-HLAG mAb – Research Grade

  • PX-TA1980-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
half IG G1-lambda2/scFv-h-CH2-CH3

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Obertamig Biosimilar - Anti-HLAG mAb - Research Grade

Product name Obertamig Biosimilar - Anti-HLAG mAb - Research Grade
Uniprot ID P17693 & P07766
Source CAS: 2750126-32-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1980
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype half IG G1-lambda2/scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name Obertamig Biosimilar - Anti-HLAG mAb - Research Grade
Uniprot ID P17693 & P07766
Source CAS: 2750126-32-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1980
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype half IG G1-lambda2/scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1980-50
Uniprot ID P17693 & P07766
Source CAS: 2750126-32-8
Species Human
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA1980
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype half IG G1-lambda2/scFv-h-CH2-CH3
Clonality Monoclonal Antibody

Introduction

Obertamig Biosimilar – Anti-HLAG mAb is a novel therapeutic antibody targeting the Human Leukocyte Antigen-G (HLA-G) protein. This biosimilar is a recombinant monoclonal antibody (mAb) that has been developed for research purposes. In this article, we will provide a detailed scientific description of the structure, activity, and potential applications of Obertamig Biosimilar – Anti-HLAG mAb.

Structure of Obertamig Biosimilar – Anti-HLAG mAb

Obertamig Biosimilar – Anti-HLAG mAb is a humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the HLA-G protein, while the constant region is responsible for effector functions such as complement activation and antibody-dependent cellular cytotoxicity.

The amino acid sequence of Obertamig Biosimilar – Anti-HLAG mAb has been engineered to have a high affinity and specificity for HLA-G. This has been achieved by using a combination of human and murine sequences, resulting in a chimeric antibody with a reduced immunogenicity potential.

Activity of Obertamig Biosimilar – Anti-HLAG mAb

The primary mode of action of Obertamig Biosimilar – Anti-HLAG mAb is the binding and neutralization of HLA-G. HLA-G is a non-classical major histocompatibility complex (MHC) class I molecule that is expressed on the surface of various cells, including tumor cells and immune cells. It plays a critical role in immune tolerance and has been implicated in the escape of tumor cells from immune surveillance.

Obertamig Biosimilar – Anti-HLAG mAb binds to HLA-G with high affinity and blocks its interaction with its receptors, including the inhibitory receptors on immune cells. This results in the activation of immune cells and the enhancement of anti-tumor immune responses. Additionally, Obertamig Biosimilar – Anti-HLAG mAb can induce antibody-dependent cellular cytotoxicity, leading to the destruction of HLA-G-expressing tumor cells.

Applications of Obertamig Biosimilar – Anti-HLAG mAb

Obertamig Biosimilar – Anti-HLAG mAb has potential applications in various fields, including cancer research and immunotherapy. Its ability to block the immunosuppressive effects of HLA-G makes it a promising candidate for the treatment of cancer. It can be used alone or in combination with other anti- cancer therapies to enhance their efficacy.

In addition to cancer, Obertamig Biosimilar – Anti-HLAG mAb has also shown potential in the treatment of autoimmune diseases. HLA-G has been implicated in the pathogenesis of various autoimmune disorders, and Obertamig Biosimilar – Anti-HLAG mAb can potentially modulate immune responses and ameliorate disease symptoms.

Furthermore, Obertamig Biosimilar – Anti-HLAG mAb can also be used as a research tool to study the role of HLA-G in immune tolerance and cancer progression. Its high specificity and affinity for HLA-G make it a valuable tool for studying the mechanisms of action of this protein and its potential as a therapeutic target.

Conclusion

In summary, Obertamig Biosimilar – Anti-HLAG mAb is a novel therapeutic antibody targeting HLA-G. Its unique structure and high specificity for HLA-G make it a promising candidate for the treatment of cancer and autoimmune diseases. It can also serve as a valuable research tool for studying the role of HLA-G in various diseases. Further studies and clinical trials are needed to fully explore the potential of Obertamig Biosimilar – Anti-HLAG mAb as a therapeutic agent.

SDS-PAGE for Research Grade Obertamig

SDS-PAGE for Research Grade Obertamig

Research Grade Obertamig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Obertamig in WB Assay

Research Grade Obertamig in WB Assay

Research Grade Obertamig can bind to its target in Western Blot Assay as detected on gel analysis.

Obertamig Biosimilar - Anti-HLAG mAb - Research Grade

There are no reviews yet.

Be the first to review “Obertamig Biosimilar – Anti-HLAG mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products