Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Nuclear factor NF-kappa-B p105 subunit(NFKB1) |
|---|---|
| Uniprot ID | P19838 |
| Uniprot link | https://www.uniprot.org/uniprot/P19838 |
| Expression system | Prokaryotic expression |
| Sequence | MGTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYLEHHHHHH |
| Molecular weight | 35.98kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >80% by SDS-PAGE |
| Buffer | PBS PH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Asp40-Tyr349 |
| Protein Accession | P19838 |
| Spec:Entrez GeneID | 4790 |
| Spec:NCBI Gene Aliases | KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta |
| Spec:SwissProtID | Q68D84 |
| NCBI Reference | P19838 |
| Aliases /Synonyms | DNA-binding factor KBF1,EBP-1,Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1, |
| Reference | PX-P4764 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.