Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Otilimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Otilimab ELISA Kit

Otilimab ELISA Kit

Product name Otilimab ELISA Kit
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX142
Note For research use only.
Sample type Plasma, Serum
Target Otilimab
Immunogen Otilimab

Introduction

Otilimab is a human monoclonal antibody that specifically binds to and inhibits the activity of the interleukin-6 receptor (IL-6R). It is a promising therapeutic target for the treatment of various autoimmune and inflammatory diseases, including rheumatoid arthritis and systemic lupus erythematosus. The Otilimab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of otilimab in biological samples. In this article, we will discuss the structure, activity, and applications of the Otilimab ELISA Kit.

Structure of Otilimab

Otilimab is a fully human monoclonal antibody, meaning it is derived from human cells and has a high affinity for its target. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the IL-6R.

Activity of Otilimab

Otilimab exerts its therapeutic activity by binding to the IL-6R and blocking the binding of IL-6, a pro-inflammatory cytokine. IL-6 is known to play a key role in the pathogenesis of autoimmune and inflammatory diseases by promoting inflammation and tissue damage. By inhibiting the IL-6/IL-6R signaling pathway, otilimab reduces the production of pro-inflammatory cytokines and chemokines, and thus, helps to control the inflammatory response.

Applications of Otilimab ELISA Kit

The Otilimab ELISA Kit is a valuable tool for the detection and quantification of otilimab in biological samples. It is widely used in preclinical and clinical studies to monitor the pharmacokinetics of otilimab, as well as to assess its efficacy and safety. The following are some of the specific applications of the Otilimab ELISA Kit:

1. Pharmacokinetic Studies: The Otilimab ELISA Kit is used to measure the concentration of otilimab in blood and other biological fluids over time. This information is essential for determining the optimal dosing regimen and for evaluating the drug’s bioavailability, distribution, metabolism, and excretion.

2. Efficacy Studies: The Otilimab ELISA Kit is also used to assess the efficacy of otilimab in clinical trials. By measuring the levels of otilimab in patients’ blood, researchers can determine whether the drug is reaching its intended target and exerting its desired effects.

3. Safety Studies: The Otilimab ELISA Kit is a useful tool for monitoring the safety of otilimab in clinical trials. By measuring the levels of otilimab in patients’ blood, researchers can ensure that the drug is not accumulating in the body and causing adverse effects.

4. Biomarker Studies: The Otilimab ELISA Kit can also be used to identify potential biomarkers for otilimab therapy. By measuring the levels of otilimab in patients’ blood, researchers can identify factors that may influence the drug’s efficacy and safety, and thus, improve patient selection and treatment outcomes.

Conclusion

In summary, the Otilimab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of otilimab in biological samples. Its applications in pharmacokinetic, efficacy, safety, and biomarker studies make it an essential tool for the development and evaluation of otilimab as a therapeutic agent. Further research and clinical trials will help to elucidate the full potential of otilimab in the treatment of autoimmune and inflammatory diseases.

Otilimab ELISA Kit

There are no reviews yet.

Be the first to review “Otilimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products