Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1950-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade

Product name Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-18-4
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1950
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-18-4
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1950
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1950-50
Uniprot ID P16410
Source CAS: 2750031-18-4
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1950
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade is a novel monoclonal antibody (mAb) that has been developed as a biosimilar of the existing anti-CD152 antibody. This biosimilar has been designed to specifically target CD152, a protein that plays a crucial role in regulating immune responses. In this article, we will delve into the structure, activity, and potential applications of Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade.

Structure of Muzastotug Biosimilar – Anti-CD152 mAb

Muzastotug Biosimilar – Anti-CD152 mAb is a recombinant humanized IgG1 monoclonal antibody that has been produced using state-of-the-art genetic engineering techniques. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the CD152 protein, while the constant region is responsible for mediating effector functions.

Activity of Muzastotug Biosimilar – Anti-CD152 mAb

The main activity of Muzastotug Biosimilar – Anti-CD152 mAb is its ability to bind to CD152, a protein that is expressed on the surface of T cells. CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), is a negative regulator of T cell activation. When CD152 is activated, it inhibits T cell activation and proliferation, thereby suppressing immune responses. Muzastotug Biosimilar – Anti-CD152 mAb binds to CD152 and blocks its inhibitory function, leading to enhanced T cell activation and proliferation.

Potential Applications of Muzastotug Biosimilar – Anti-CD152 mAb

Muzastotug Biosimilar – Anti-CD152 mAb has potential applications in various therapeutic areas, including cancer, autoimmune diseases, and transplantation. In cancer, the antibody can be used to enhance the anti-tumor immune response by boosting T cell activation and proliferation. This can be particularly beneficial in combination with other cancer treatments such as chemotherapy or immune checkpoint inhibitors.

In autoimmune diseases, Muzastotug Biosimilar – Anti-CD152 mAb can be used to suppress overactive immune responses that contribute to the pathogenesis of diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By blocking CD152, the antibody can prevent the inhibitory signals that dampen immune responses, leading to enhanced immune activity and reduced disease severity.

In transplantation, Muzastotug Biosimilar – Anti-CD152 mAb can be used to prevent organ rejection. During organ transplantation, the body’s immune system recognizes the transplanted organ as foreign and mounts an immune response to reject it. By blocking CD152, the antibody can prevent the inhibitory signals that suppress immune responses, allowing for better acceptance of the transplanted organ.

Conclusion

Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade is a novel monoclonal antibody that has been designed to target CD152, a protein that plays a crucial role in regulating immune responses. Its structure, activity, and potential applications make it a promising therapeutic option in various disease settings. Further research and clinical trials are needed to fully explore the potential of this biosimilar in improving patient outcomes.

Research Grade Muzastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Muzastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Muzastotug in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Muzastotug

SDS-PAGE for Research Grade Muzastotug

Research Grade Muzastotug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products