Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse EFNB1 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P52795

Original price was: €410.00.Current price is: €325.00.

100ug 21% OFF + 325 loyalty points
Met1–Ser229 Fc
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse EFNB1 Recombinant Protein, C-Fc

Mouse EFNB1 Recombinant Protein, C-Fc

Product name ARO-P18188-100
Uniprot ID P52795
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser229
Aliases /Synonyms Ephrin-B1, CEK5 receptor ligand, CEK5-L, EFL-3, ELK ligand, ELK-L, EPH-related receptor tyrosine kinase ligand 2, LERK-2, Stimulated by retinoic acid gene 1 protein, Ephrin-B1 C-terminal fragment, Ephrin-B1 CTF, Ephrin-B1 intracellular domain, Ephrin-B1 ICD, Efnb1, Epl2, Eplg2, Lerk2, Stra1
Reference ARO-P18188
Note For research use only.
Molecular Constructor
Met1–Ser229 Fc
Product name ARO-P18188-1MG
Uniprot ID P52795
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser229
Aliases /Synonyms Ephrin-B1, CEK5 receptor ligand, CEK5-L, EFL-3, ELK ligand, ELK-L, EPH-related receptor tyrosine kinase ligand 2, LERK-2, Stimulated by retinoic acid gene 1 protein, Ephrin-B1 C-terminal fragment, Ephrin-B1 CTF, Ephrin-B1 intracellular domain, Ephrin-B1 ICD, Efnb1, Epl2, Eplg2, Lerk2, Stra1
Reference ARO-P18188
Note For research use only.
Molecular Constructor
Met1–Ser229 Fc
Product name ARO-P18188-50
Uniprot ID P52795
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser229
Aliases /Synonyms Ephrin-B1, CEK5 receptor ligand, CEK5-L, EFL-3, ELK ligand, ELK-L, EPH-related receptor tyrosine kinase ligand 2, LERK-2, Stimulated by retinoic acid gene 1 protein, Ephrin-B1 C-terminal fragment, Ephrin-B1 CTF, Ephrin-B1 intracellular domain, Ephrin-B1 ICD, Efnb1, Epl2, Eplg2, Lerk2, Stra1
Reference ARO-P18188
Note For research use only.
Molecular Constructor
Met1–Ser229 Fc

SDS-PAGE for Mouse EFNB1 Recombinant Protein, C-Fc

SDS-PAGE for Mouse EFNB1 Recombinant Protein, C-Fc

Mouse EFNB1 Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Mouse EFNB1 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products