Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD122/IL2RB Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P16297

Original price was: €280.00.Current price is: €228.00.

50ug 19% OFF + 228 loyalty points
Ala27–Glu240 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse CD122/IL2RB Recombinant Protein, C-Fc

Mouse CD122/IL2RB Recombinant Protein, C-Fc

Product name PX-P7033-100
Uniprot ID P16297
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Glu240
Aliases /Synonyms Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, Interleukin-15 receptor subunit beta, p70-75, p75, CD122, IL2RB
Reference PX-P7033
Note For research use only.
Molecular Constructor
Ala27–Glu240 Fc
Product name PX-P7033-1MG
Uniprot ID P16297
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Glu240
Aliases /Synonyms Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, Interleukin-15 receptor subunit beta, p70-75, p75, CD122, IL2RB
Reference PX-P7033
Note For research use only.
Molecular Constructor
Ala27–Glu240 Fc
Product name PX-P7033-50
Uniprot ID P16297
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Glu240
Aliases /Synonyms Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, Interleukin-15 receptor subunit beta, p70-75, p75, CD122, IL2RB
Reference PX-P7033
Note For research use only.
Molecular Constructor
Ala27–Glu240 Fc

SDS-PAGE for Mouse CD122/IL2RB Recombinant Protein, C-Fc

SDS-PAGE for Mouse CD122/IL2RB Recombinant Protein, C-Fc

Mouse CD122/IL2RB Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Mouse CD122/IL2RB Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products