Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse Reg3b Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P35230

Original price was: €267.00.Current price is: €228.00.

50ug 15% OFF + 228 loyalty points
Met1–Gly175 Fc
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse Reg3b Recombinant Protein, C-Fc

Mouse Reg3b Recombinant Protein, C-Fc

Product name ARO-P17984-100
Uniprot ID P35230
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly175
Aliases /Synonyms Regenerating islet-derived protein 3-beta, REG-3-beta, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-beta, Reg III-beta, Regenerating islet-derived protein 3-beta 16.5 kDa form, Regenerating islet-derived protein 3-beta 15 kDa form, Reg3b, Pap1
Reference ARO-P17984
Note For research use only.
Molecular Constructor
Met1–Gly175 Fc
Product name ARO-P17984-1MG
Uniprot ID P35230
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly175
Aliases /Synonyms Regenerating islet-derived protein 3-beta, REG-3-beta, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-beta, Reg III-beta, Regenerating islet-derived protein 3-beta 16.5 kDa form, Regenerating islet-derived protein 3-beta 15 kDa form, Reg3b, Pap1
Reference ARO-P17984
Note For research use only.
Molecular Constructor
Met1–Gly175 Fc
Product name ARO-P17984-50
Uniprot ID P35230
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly175
Aliases /Synonyms Regenerating islet-derived protein 3-beta, REG-3-beta, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-beta, Reg III-beta, Regenerating islet-derived protein 3-beta 16.5 kDa form, Regenerating islet-derived protein 3-beta 15 kDa form, Reg3b, Pap1
Reference ARO-P17984
Note For research use only.
Molecular Constructor
Met1–Gly175 Fc

There are no reviews yet.

Be the first to review “Mouse Reg3b Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products