Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse FCGRT & B2M Heterodimer Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q61559 & P01887

Original price was: €280.00.Current price is: €228.00.

50ug 19% OFF + 228 loyalty points
Ser22–Ser297 His
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse FCGRT & B2M Heterodimer Recombinant Protein, C-His

Mouse FCGRT & B2M Heterodimer Recombinant Protein, C-His

Product name ARO-P17986-100
Uniprot ID Q61559 & P01887
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence SETRPPLMYHLTAVSNPSTGLPSFWATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLWMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSSARSS
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser22-Ser297
Aliases /Synonyms IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, FcRn, FCGRT, FCRN, Neonatal Fc receptor
Reference ARO-P17986
Note For research use only.
Molecular Constructor
Ser22–Ser297 His
Product name ARO-P17986-1MG
Uniprot ID Q61559 & P01887
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence SETRPPLMYHLTAVSNPSTGLPSFWATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLWMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSSARSS
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser22-Ser297
Aliases /Synonyms IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, FcRn, FCGRT, FCRN, Neonatal Fc receptor
Reference ARO-P17986
Note For research use only.
Molecular Constructor
Ser22–Ser297 His
Product name ARO-P17986-50
Uniprot ID Q61559 & P01887
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence SETRPPLMYHLTAVSNPSTGLPSFWATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLWMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSSARSS
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser22-Ser297
Aliases /Synonyms IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, FcRn, FCGRT, FCRN, Neonatal Fc receptor
Reference ARO-P17986
Note For research use only.
Molecular Constructor
Ser22–Ser297 His

There are no reviews yet.

Be the first to review “Mouse FCGRT & B2M Heterodimer Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products