Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse Arginine deiminase type-4 Recombinant Protein

Host species:
Insect
Origin species:
House Mouse
Uniprot ID:
Q9Z183
Molecular weight:
100.24 kDa

420.00

100ug + 420 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse Arginine deiminase type-4 Recombinant Protein

Product name Mouse Arginine deiminase type-4 Recombinant Protein
Uniprot ID Q9Z183
Uniprot link http://www.uniprot.org/uniprot/Q9Z183
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMAQGAVIHVAPEQPTHAVCVVGTATPLDVRGSA
Molecular weight 100.24 kDa
Protein delivered with Tag? Yes
Purity estimated 20%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
Protein Accession NP_035191.2
Spec:Entrez GeneID 18602
Spec:NCBI Gene Aliases Pad4, Pdi4
Spec:SwissProtID Q9Z183
NCBI Reference NP_035191.2
Aliases /Synonyms Protein-arginine deiminase type-4 Mouse, peptidyl arginine deiminase, type IV, Protein-arginine deiminase type-4, Peptidylarginine deiminase IV, Protein-arginine deiminase type IV
Reference PX-P2085
Note For research use only
Molecular Constructor
Full-length Yes
Product name Mouse Arginine deiminase type-4 Recombinant Protein
Uniprot ID Q9Z183
Uniprot link http://www.uniprot.org/uniprot/Q9Z183
Origin species House Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMAQGAVIHVAPEQPTHAVCVVGTATPLDVRGSA
Molecular weight 100.24 kDa
Protein delivered with Tag? Yes
Purity estimated 20%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
Protein Accession NP_035191.2
Spec:Entrez GeneID 18602
Spec:NCBI Gene Aliases Pad4, Pdi4
Spec:SwissProtID Q9Z183
NCBI Reference NP_035191.2
Aliases /Synonyms Protein-arginine deiminase type-4 Mouse, peptidyl arginine deiminase, type IV, Protein-arginine deiminase type-4, Peptidylarginine deiminase IV, Protein-arginine deiminase type IV
Reference PX-P2085
Note For research use only
Molecular Constructor
Full-length Yes

General Information on Mouse Arginine deiminase type-4 Recombinant Protein:

PADI4 is located in the cytoplasm, nucleus and in cytoplasmic granules of eosinophils and neutrophils. It is not expressed in peripheral monocytes or lymphocytes. It is also expressed in rheumatoid arthritis synovial tissues. It may play a role in in granulocyte and macrophage development leading to inflammation and immune response. PADI4 plays a role in the epigenetics, the deimination of arginines on histones 3 and 4 can act antagonistically to arginine methylation.

  • Erpenbeck L, Chowdhury CS, Zsengellér ZK, Gallant M, Burke SD, Cifuni S, Hahn S, Wagner DD, Karumanchi SA. PAD4 Deficiency Decreases Inflammation andSusceptibility to Pregnancy Loss in a Mouse Model. Biol Reprod. 2016Dec;95(6):132. doi: 10.1095/biolreprod.116.140293. Epub 2016 Nov 9. PubMed PMID: 28007693; PubMed Central PMCID: PMC5315429.
  • Seri Y, Shoda H, Suzuki A, Matsumoto I, Sumida T, Fujio K, Yamamoto K.Peptidylarginine deiminase type 4 deficiency reduced arthritis severity in aglucose-6-phosphate isomerase-induced arthritis model. Sci Rep. 2015 Aug21;5:13041. doi: 10.1038/srep13041. PubMed PMID: 26293116; PubMed Central PMCID: PMC4544002.
  • Christophorou MA, Castelo-Branco G, Halley-Stott RP, Oliveira CS, Loos R,Radzisheuskaya A, Mowen KA, Bertone P, Silva JC, Zernicka-Goetz M, Nielsen ML,Gurdon JB, Kouzarides T. Citrullination regulates pluripotency and histone H1binding to chromatin. Nature. 2014 Mar 6;507(7490):104-8. doi:10.1038/nature12942. Epub 2014 Jan 26. PubMed PMID: 24463520; PubMed CentralPMCID: PMC4843970.
  • Knight JS, Luo W, O'Dell AA, Yalavarthi S, Zhao W, Subramanian V, Guo C, GrennRC, Thompson PR, Eitzman DT, Kaplan MJ. Peptidylarginine deiminase inhibitionreduces vascular damage and modulates innate immune responses in murine models ofatherosclerosis. Circ Res. 2014 Mar 14;114(6):947-56. doi:10.1161/CIRCRESAHA.114.303312. Epub 2014 Jan 14. PubMed PMID: 24425713; PubMedCentral PMCID: PMC4185401.
  • Martinod K, Demers M, Fuchs TA, Wong SL, Brill A, Gallant M, Hu J, Wang Y,Wagner DD. Neutrophil histone modification by peptidylarginine deiminase 4 iscritical for deep vein thrombosis in mice. Proc Natl Acad Sci U S A. 2013 May21;110(21):8674-9. doi: 10.1073/pnas.1301059110. Epub 2013 May 6. PubMed PMID:23650392; PubMed Central PMCID: PMC3666755.
  • Rohrbach AS, Hemmers S, Arandjelovic S, Corr M, Mowen KA. PAD4 is notessential for disease in the K/BxN murine autoantibody-mediated model ofarthritis. Arthritis Res Ther. 2012 May 2;14(3):R104. doi: 10.1186/ar3829. PubMedPMID: 22551352; PubMed Central PMCID: PMC3446481.
  • Wong SL, Demers M, Martinod K, Gallant M, Wang Y, Goldfine AB, Kahn CR, WagnerDD. Diabetes primes neutrophils to undergo NETosis, which impairs wound healing. Nat Med. 2015 Jul;21(7):815-9. doi: 10.1038/nm.3887. Epub 2015 Jun 15. PubMedPMID: 26076037; PubMed Central PMCID: PMC4631120.
  • Rosilio C, Nebout M, Imbert V, Griessinger E, Neffati Z, Benadiba J, HagenbeekT, Spits H, Reverso J, Ambrosetti D, Michiels JF, Bailly-Maitre B, Endou H, WempeMF, Peyron JF. L-type amino-acid transporter 1 (LAT1): a therapeutic targetsupporting growth and survival of T-cell lymphoblastic lymphoma/T-cell acutelymphoblastic leukemia. Leukemia. 2015 Jun;29(6):1253-66. doi:10.1038/leu.2014.338. Epub 2014 Dec 8. PubMed PMID: 25482130.
  • Ham A, Rabadi M, Kim M, Brown KM, Ma Z, D'Agati V, Lee HT. Peptidyl argininedeiminase-4 activation exacerbates kidney ischemia-reperfusion injury. Am JPhysiol Renal Physiol. 2014 Nov 1;307(9):F1052-62. doi:10.1152/ajprenal.00243.2014. Epub 2014 Aug 27. PubMed PMID: 25164081; PubMedCentral PMCID: PMC4216984.
  • Nakashima K, Arai S, Suzuki A, Nariai Y, Urano T, Nakayama M, Ohara O,Yamamura K, Yamamoto K, Miyazaki T. PAD4 regulates proliferation of multipotenthaematopoietic cells by controlling c-myc expression. Nat Commun. 2013;4:1836.doi: 10.1038/ncomms2862. PubMed PMID: 23673621; PubMed Central PMCID: PMC3674250.
  • Moscarello MA, Lei H, Mastronardi FG, Winer S, Tsui H, Li Z, Ackerley C,Zhang L, Raijmakers R, Wood DD. Inhibition of peptidyl-arginine deiminasesreverses protein-hypercitrullination and disease in mouse models of multiplesclerosis. Dis Model Mech. 2013 Mar;6(2):467-78. doi: 10.1242/dmm.010520. Epub2012 Nov 1. PubMed PMID: 23118341; PubMed Central PMCID: PMC3597028.
  • Hemmers S, Teijaro JR, Arandjelovic S, Mowen KA. PAD4-mediated neutrophilextracellular trap formation is not required for immunity against influenzainfection. PLoS One. 2011;6(7):e22043. doi: 10.1371/journal.pone.0022043. Epub2011 Jul 11. PubMed PMID: 21779371; PubMed Central PMCID: PMC3133614.
  • Wood DD, Ackerley CA, Brand Bv, Zhang L, Raijmakers R, Mastronardi FG,Moscarello MA. Myelin localization of peptidylarginine deiminases 2 and 4:comparison of PAD2 and PAD4 activities. Lab Invest. 2008 Apr;88(4):354-64. doi:10.1038/labinvest.3700748. Epub 2008 Jan 28. PubMed PMID: 18227806.
  • Savchenko AS, Borissoff JI, Martinod K, De Meyer SF, Gallant M, Erpenbeck L, Brill A, Wang Y, Wagner DD. VWF-mediated leukocyte recruitment with chromatindecondensation by PAD4 increases myocardial ischemia/reperfusion injury in mice. Blood. 2014 Jan 2;123(1):141-8. doi: 10.1182/blood-2013-07-514992. Epub 2013 Nov 7. PubMed PMID: 24200682; PubMed Central PMCID: PMC3879903.
  • Arandjelovic S, McKenney KR, Leming SS, Mowen KA. ATP induces proteinarginine deiminase 2-dependent citrullination in mast cells through the P2X7purinergic receptor. J Immunol. 2012 Oct 15;189(8):4112-22. doi:10.4049/jimmunol.1201098. Epub 2012 Sep 14. PubMed PMID: 22984079; PubMed CentralPMCID: PMC3466374.

There are no reviews yet.

Be the first to review “Mouse Arginine deiminase type-4 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products