Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MOR106 Biosimilar – Anti-Cytokine CX2 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade

Product name MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade
Uniprot ID Q9P0M4
Species Mouse
Expression system XtenCHO
Raw Antigen Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Cytokine CX2,IL17C,IL-17C,Interleukin-17C,
Reference PX-TA1904
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade
Uniprot ID Q9P0M4
Species Mouse
Expression system XtenCHO
Raw Antigen Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Cytokine CX2,IL17C,IL-17C,Interleukin-17C,
Reference PX-TA1904
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1904-50
Uniprot ID Q9P0M4
Species Mouse
Expression system XtenCHO
Raw Antigen Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Cytokine CX2,IL17C,IL-17C,Interleukin-17C,
Reference PX-TA1904
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

MOR106 Biosimilar is a promising new therapeutic antibody that targets the cytokine CX2, also known as interleukin-8 (IL-8). This biosimilar is a research grade version of the original MOR106 antibody, which has shown promising results in preclinical studies for the treatment of several inflammatory diseases. In this article, we will explore the structure, activity, and potential applications of MOR106 Biosimilar in more detail.

Structure of MOR106 Biosimilar

MOR106 Biosimilar is a monoclonal antibody (mAb) that specifically binds to CX2. It is a biosimilar version of the original MOR106 antibody, meaning that it has a highly similar structure and function to the original antibody. The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of the antibody, responsible for binding to CX2, are located at the tips of the heavy and light chains.

Activity of MOR106 Biosimilar

The main activity of MOR106 Biosimilar is its ability to bind to CX2 and inhibit its function. CX2 is a pro-inflammatory cytokine that plays a crucial role in the recruitment and activation of immune cells during inflammation. By binding to CX2, MOR106 Biosimilar prevents it from interacting with its receptors on immune cells, thus reducing the inflammatory response. This makes MOR106 Biosimilar a potent anti-inflammatory agent.

In addition to its direct effect on CX2, MOR106 Biosimilar also has an indirect effect on other inflammatory cytokines. CX2 is known to stimulate the production of other pro-inflammatory cytokines, such as tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β). By inhibiting CX2, MOR106 Biosimilar can also indirectly reduce the levels of these cytokines, further suppressing the inflammatory response.

Potential Applications of MOR106 Biosimilar

MOR106 Biosimilar has shown promising results in preclinical studies for the treatment of various inflammatory diseases, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease. These diseases are characterized by an overactive immune response and elevated levels of CX2 and other pro-inflammatory cytokines. By inhibiting CX2, MOR106 Biosimilar has the potential to reduce inflammation and alleviate symptoms in these conditions.

Furthermore, CX2 has also been implicated in cancer progression and metastasis. It promotes tumor growth and angiogenesis, as well as the migration and invasion of cancer cells. Therefore, MOR106 Biosimilar may also have potential applications in cancer treatment by inhibiting CX2 and reducing its pro-tumorigenic effects.

Another potential application of MOR106 Biosimilar is in combination therapy with other anti-inflammatory drugs. By targeting CX2, MOR106 Biosimilar can complement the effects of other drugs that target different inflammatory pathways, providing a more comprehensive and effective treatment approach.

Conclusion

In summary, MOR106 Biosimilar is a research grade version of the original MOR106 antibody that specifically targets the pro-inflammatory cytokine CX2. Its structure and function are highly similar to the original antibody, making it a potent and specific inhibitor of CX2. Through its direct and indirect effects on CX2 and other pro-inflammatory cytokines, MOR106 Biosimilar has the potential to treat various inflammatory diseases, as well as cancer. Further research and clinical trials are needed to fully evaluate the efficacy and safety of this promising therapeutic antibody.

SDS-PAGE for Research Grade MOR106

SDS-PAGE for Research Grade MOR106

Research Grade MOR106, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

MOR106 Biosimilar - Anti-Cytokine CX2 mAb - Research Grade

There are no reviews yet.

Be the first to review “MOR106 Biosimilar – Anti-Cytokine CX2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products