Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MARV VP24 recombinant protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Lake Victoria marburgvirus (strain Musoke-80) (MARV)
Uniprot ID:
P35256
Molecular weight:
55.31 kDa

GST Thr55–Leu241 His

This product is currently out of stock and unavailable.

  • Out of Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
MARV VP24 recombinant protein, N-GST & C-His

MARV VP24 recombinant protein, N-GST & C-His

Product name MARV VP24 recombinant protein, N-GST & C-His
Uniprot ID P35256
Origin species Lake Victoria marburgvirus (strain Musoke-80) (MARV)
Expression system Prokaryotic expression
Raw Antigen Sequence TLLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFLALRILLGVALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVEVRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQMEKGQPL
Molecular weight 55.31 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Leu241
Aliases /Synonyms Membrane-associated protein VP24, Marburg VP24, mVP24, VP24
Reference ARO-P22638
Note For research use only.
Molecular Constructor
GST Thr55–Leu241 His

There are no reviews yet.

Be the first to review “MARV VP24 recombinant protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products