Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
Q8V4U9
Molecular weight:
15.70 kDa

302.00

100ug + 302 loyalty points
His Glu28–Leu146
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE For Monkeypox virus/MPXV A30L Recombinant Protein, N-His
Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Product name Monkeypox virus/MPXV A30L Recombinant Protein, N-His
Uniprot ID Q8V4U9
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence ENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
Molecular weight 15.70 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from PBS pH7.4,0.02%NLS,1mM EDTA, 4%trehalose,1% mannitol
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu28-Leu146
Aliases /Synonyms Envelope protein A28 homolog, Protein A30, A30L, Monkeypox virus (MPXV), clade 2
Reference PX-P6073
Note For research use only.
Molecular Constructor
His Glu28–Leu146

SDS-PAGE For Monkeypox virus/MPXV A30L Recombinant Protein, N-His

SDS-PAGE For Monkeypox virus/MPXV A30L Recombinant Protein, N-His

Monkeypox virus/MPXV A30L Recombinant Protein, N-His, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Monkeypox virus/MPXV A30L Recombinant Protein, N-His

There are no reviews yet.

Be the first to review “Monkeypox virus/MPXV A30L Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products