Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
AAN78222.1
Molecular weight:
41.93 kDa

302.00

100ug + 302 loyalty points
GST Val57–Thr181 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE For Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His
Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His

Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His

Product name Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His
Uniprot ID AAN78222.1
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCT
Molecular weight 41.93 kDa
Protein delivered with Tag? N-terminal GST and C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from PBS pH7.4,0.02%NLS,1mM EDTA, 4%trehalose,1% mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val57-Thr181
Aliases /Synonyms A35R, Bifunctional EEV membrane phosphoglycoprotein, Bifunctional EEV membrane phosphoglycoprotein/associates with A36R, Bifunctional EEV membrane protein, EEV membrane phosphoglycoprotein, EEV membrane phosphoglycoprotein C-type, C-type lectin-like domain, MPXV-COP-139, MPXV-SL-139, MPXV-WRAIR139, Monkeypox virus (MPXV), clade 2
Reference PX-P6075
Note For research use only.
Molecular Constructor
GST Val57–Thr181 His

SDS-PAGE For Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His

SDS-PAGE For Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His

Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Monkeypox virus/MPXV A35R Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products