Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lucatumumab Biosimilar – Anti-CD40 mAb – Research Grade

  • PX-TA1130-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Product name Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 903512-50-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lucatumumab,CHIR-12,12,HCD122,CD40,anti-CD40
Reference PX-TA1130
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade
Uniprot ID P25942
Source CAS 903512-50-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lucatumumab,CHIR-12,12,HCD122,CD40,anti-CD40
Reference PX-TA1130
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1130-50
Uniprot ID P25942
Source CAS 903512-50-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lucatumumab,CHIR-12,12,HCD122,CD40,anti-CD40
Reference PX-TA1130
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Lucatumumab Biosimilar, also known as Anti-CD40 mAb, is a monoclonal antibody that targets the CD40 protein. This protein is a cell surface receptor found on various immune cells, including B cells, dendritic cells, and macrophages. Lucatumumab Biosimilar is a research-grade antibody that has shown promising results in preclinical studies and is being developed as a potential therapeutic for various diseases.

Structure of Lucatumumab Biosimilar

Lucatumumab Biosimilar is a humanized IgG1 monoclonal antibody, meaning it is derived from human antibodies and has been modified to reduce immunogenicity. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. The variable regions of the antibody are responsible for binding to the CD40 protein.

Activity of Lucatumumab Biosimilar

Lucatumumab Biosimilar works by binding to the CD40 protein on the surface of immune cells. This binding activates the CD40 signaling pathway, leading to the activation of immune cells and the production of cytokines and other immune mediators. This activation of the immune system can help fight against various diseases, including cancer, autoimmune disorders, and infectious diseases.

Application of Lucatumumab Biosimilar

Lucatumumab Biosimilar is being investigated as a potential therapeutic for various diseases, including B-cell lymphomas, multiple myeloma, and solid tumors. In preclinical studies, it has shown promising results in inhibiting tumor growth and promoting anti-tumor immune responses. It has also shown potential for use in combination with other cancer treatments, such as chemotherapy and immune checkpoint inhibitors.

In addition to its potential as an anti-

cancer therapy, Lucatumumab Biosimilar is also being studied for its potential in treating autoimmune disorders, such as rheumatoid arthritis and systemic lupus erythematosus. By activating the immune system, it may help regulate the immune response and reduce inflammation associated with these diseases.

Lucatumumab Biosimilar is also being investigated for its potential in infectious diseases. By stimulating the immune system, it may help fight against viral and bacterial infections. It has shown promising results in preclinical studies for the treatment of viral infections, such as influenza and hepatitis B.

Conclusion

Lucatumumab Biosimilar, also known as Anti-CD40 mAb, is a research-grade monoclonal antibody that targets the CD40 protein. Its structure, activity, and potential applications make it a promising therapeutic for various diseases. Further research and clinical trials are needed to fully understand its potential and efficacy in treating these diseases. However, Lucatumumab Biosimilar holds great promise as a potential treatment option for cancer, autoimmune disorders, and infectious diseases.

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using FITC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD40 monoclonal antibody (Catalog: PX-TA1130, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade binds to CD40 Recombinant Protein in ELISA Assay

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade binds to CD40 Recombinant Protein in ELISA Assay

CD40 Recombinant Protein(cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

SDS-PAGE for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using APC anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD40 monoclonal antibody (Catalog: PX-TA1130, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow Cytometry results for Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

Flow-cytometry using PE anti-human CD40 antibody. U2OS cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD40 monoclonal antibody (Catalog: PX-TA1130, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Lucatumumab Biosimilar - Anti-CD40 mAb - Research Grade

There are no reviews yet.

Be the first to review “Lucatumumab Biosimilar – Anti-CD40 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products